prot_L-elsbetiae_contig13803.2876.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13803.2876.1 vs. uniprot
Match: D7FP86_ECTSI (Cnd1 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FP86_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 2.440e-6 Identity = 28/36 (77.78%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 1 MSTGKADVPPRSRDCVKAHQGAIKVTQAIAAALRGA 36 M+TGKADVPPRSRDCVKAH AI +AIAAALR A Sbjct: 332 MTTGKADVPPRSRDCVKAHNSAIDTAKAIAAALRNA 367
BLAST of mRNA_L-elsbetiae_contig13803.2876.1 vs. uniprot
Match: A0A6H5JQJ4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQJ4_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 2.920e-6 Identity = 27/36 (75.00%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 1 MSTGKADVPPRSRDCVKAHQGAIKVTQAIAAALRGA 36 M+TGKADVPPRSRDCVKAH A+ +AIAAALR A Sbjct: 210 MNTGKADVPPRSRDCVKAHNSAVDTAKAIAAALRNA 245 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13803.2876.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13803.2876.1 ID=prot_L-elsbetiae_contig13803.2876.1|Name=mRNA_L-elsbetiae_contig13803.2876.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=170bpback to top |