mRNA_L-elsbetiae_contig13482.2668.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13482.2668.1 vs. uniprot
Match: D8LDN0_ECTSI (Zinc finger protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDN0_ECTSI) HSP 1 Score: 56.6 bits (135), Expect = 1.420e-7 Identity = 26/31 (83.87%), Postives = 26/31 (83.87%), Query Frame = -1 Query: 1 LRVPQGCKVTEIRDMKSLWGALEKCLYDGAN 93 L QGCKVTEIRDM SLW ALEKCLYDGAN Sbjct: 16 LAFTQGCKVTEIRDMGSLWRALEKCLYDGAN 46
BLAST of mRNA_L-elsbetiae_contig13482.2668.1 vs. uniprot
Match: A0A6H5KTC5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KTC5_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 6.120e-7 Identity = 26/31 (83.87%), Postives = 26/31 (83.87%), Query Frame = -1 Query: 1 LRVPQGCKVTEIRDMKSLWGALEKCLYDGAN 93 L QGCKVTEIRDM SLW ALEKCLYDGAN Sbjct: 539 LAFTQGCKVTEIRDMGSLWRALEKCLYDGAN 569 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13482.2668.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13482.2668.1 >prot_L-elsbetiae_contig13482.2668.1 ID=prot_L-elsbetiae_contig13482.2668.1|Name=mRNA_L-elsbetiae_contig13482.2668.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=103bp VSPVVQALFQGPPQALHISDLRHFTTLRDAQYSTAHTKDFTGGSRRHPFSback to top mRNA from alignment at L-elsbetiae_contig13482:3158..3502+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13482.2668.1 ID=mRNA_L-elsbetiae_contig13482.2668.1|Name=mRNA_L-elsbetiae_contig13482.2668.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=345bp|location=Sequence derived from alignment at L-elsbetiae_contig13482:3158..3502+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13482:3158..3502+ >mRNA_L-elsbetiae_contig13482.2668.1 ID=mRNA_L-elsbetiae_contig13482.2668.1|Name=mRNA_L-elsbetiae_contig13482.2668.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=618bp|location=Sequence derived from alignment at L-elsbetiae_contig13482:3158..3502+ (Laminarionema elsbetiae ELsaHSoW15)back to top |