prot_L-elsbetiae_contig128.2249.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig128.2249.1 vs. uniprot
Match: D8LB94_ECTSI (Similar to AHNAK nucleoprotein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LB94_ECTSI) HSP 1 Score: 62.8 bits (151), Expect = 6.880e-8 Identity = 29/40 (72.50%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 82 EVKKPKKGLFGSIFGGSKGKIEVPDTDVPGDMSVPDVSGS 121 +V+KPKKGLFG +FG SKGKIEVPD DV D S+P+VSGS Sbjct: 846 DVQKPKKGLFGGLFGSSKGKIEVPDADVSADASLPNVSGS 885
BLAST of mRNA_L-elsbetiae_contig128.2249.1 vs. uniprot
Match: A0A6H5K9M1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K9M1_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.030e-6 Identity = 29/40 (72.50%), Postives = 32/40 (80.00%), Query Frame = 0 Query: 82 EVKKPKKGLFGSIFGGSKGKIEVPDTDVPGDMSVPDVSGS 121 +V+KPKKGLFGSIFG SK IEVPD DV D S+P VSGS Sbjct: 724 DVQKPKKGLFGSIFGSSKTNIEVPDADVSADASLPGVSGS 763 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig128.2249.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig128.2249.1 ID=prot_L-elsbetiae_contig128.2249.1|Name=mRNA_L-elsbetiae_contig128.2249.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=209bpback to top |