mRNA_L-elsbetiae_contig9981.18907.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9981.18907.1 vs. uniprot
Match: D8LTT7_ECTSI (Polymorphic Outer membrane protein G/I family n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTT7_ECTSI) HSP 1 Score: 65.1 bits (157), Expect = 4.360e-10 Identity = 31/41 (75.61%), Postives = 33/41 (80.49%), Query Frame = 1 Query: 4 DVRWESLAAEGAGGAIFAQDGTNVTLTGLHLFQGCSSSALG 126 DVRWESL+AEGAGGAI+AQDG VTL GLH F CSS LG Sbjct: 198 DVRWESLSAEGAGGAIYAQDGGTVTLKGLHHFHNCSSGTLG 238
BLAST of mRNA_L-elsbetiae_contig9981.18907.1 vs. uniprot
Match: A0A6H5JUJ2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUJ2_9PHAE) HSP 1 Score: 62.4 bits (150), Expect = 3.840e-9 Identity = 29/41 (70.73%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 4 DVRWESLAAEGAGGAIFAQDGTNVTLTGLHLFQGCSSSALG 126 DVRW+SL+ EGAGGAI+AQDG VTL GLH F CSS LG Sbjct: 201 DVRWDSLSVEGAGGAIYAQDGGTVTLKGLHHFHNCSSGTLG 241 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9981.18907.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig9981.18907.1 >prot_L-elsbetiae_contig9981.18907.1 ID=prot_L-elsbetiae_contig9981.18907.1|Name=mRNA_L-elsbetiae_contig9981.18907.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=102bp EDVRWESLAAEGAGGAIFAQDGTNVTLTGLHLFQGCSSSALGGGALFVQNback to top mRNA from alignment at L-elsbetiae_contig9981:5152..5457+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig9981.18907.1 ID=mRNA_L-elsbetiae_contig9981.18907.1|Name=mRNA_L-elsbetiae_contig9981.18907.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=306bp|location=Sequence derived from alignment at L-elsbetiae_contig9981:5152..5457+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig9981:5152..5457+ >mRNA_L-elsbetiae_contig9981.18907.1 ID=mRNA_L-elsbetiae_contig9981.18907.1|Name=mRNA_L-elsbetiae_contig9981.18907.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=612bp|location=Sequence derived from alignment at L-elsbetiae_contig9981:5152..5457+ (Laminarionema elsbetiae ELsaHSoW15)back to top |