mRNA_L-elsbetiae_contig7075.15880.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: A0A6H5KJ07_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJ07_9PHAE) HSP 1 Score: 90.9 bits (224), Expect = 7.360e-21 Identity = 41/49 (83.67%), Postives = 44/49 (89.80%), Query Frame = 1 Query: 4 PATKHLLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANRENRGVR 150 P + LLYVGDHMFADILRS RTLGWRTCL+VPELESEMNANRENR +R Sbjct: 50 PVVQKLLYVGDHMFADILRSKRTLGWRTCLIVPELESEMNANRENRDLR 98
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: A0A6H5JY87_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JY87_9PHAE) HSP 1 Score: 88.2 bits (217), Expect = 7.610e-19 Identity = 40/44 (90.91%), Postives = 42/44 (95.45%), Query Frame = 1 Query: 19 LLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANRENRGVR 150 LLYVGDHMFADILRS RTLGWRTCL+VPELESEMNANRENR +R Sbjct: 827 LLYVGDHMFADILRSKRTLGWRTCLIVPELESEMNANRENRDLR 870
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: D7FMF3_ECTSI (5'-nucleotidase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMF3_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 9.110e-18 Identity = 38/44 (86.36%), Postives = 42/44 (95.45%), Query Frame = 1 Query: 19 LLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANRENRGVR 150 LLYVGDHMFADILRS RTLGWRTCL+VPELE+EM+ANRENR +R Sbjct: 443 LLYVGDHMFADILRSKRTLGWRTCLIVPELENEMSANRENRDLR 486
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: A0A7S2WQY2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WQY2_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 1.440e-14 Identity = 32/42 (76.19%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 7 ATKHLLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANR 132 A + LLYVGDHM++DILRS RTLGWRTCLV+PELE EMN R Sbjct: 25 AGERLLYVGDHMYSDILRSKRTLGWRTCLVIPELEVEMNTYR 66
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: A0A7S0SZA1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Chromulina nebulosa TaxID=96789 RepID=A0A7S0SZA1_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 1.860e-12 Identity = 31/42 (73.81%), Postives = 37/42 (88.10%), Query Frame = 1 Query: 19 LLYVGDHMFADILRSTRTLGWRTCLVVPELESEMN-ANRENR 141 +LYVGDHMFADILRS RTLGWRTCL++PELE E+ A RE++ Sbjct: 247 ILYVGDHMFADILRSKRTLGWRTCLIIPELEHELETAQRESK 288
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: A0A7S2EHS9_TRICV (Hypothetical protein n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S2EHS9_TRICV) HSP 1 Score: 68.6 bits (166), Expect = 2.630e-12 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 1 VPATKHLLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANRENRGVRR 153 V A + ++YVGDH++AD+LRS RTLGWR+C +VPEL EM RE +RR Sbjct: 71 VEAGEEIMYVGDHLYADVLRSKRTLGWRSCFIVPELAEEMRVFREQLPLRR 121
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: A0A835Z4H4_9STRA (5'-nucleotidase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z4H4_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 3.250e-12 Identity = 30/44 (68.18%), Postives = 37/44 (84.09%), Query Frame = 1 Query: 19 LLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANRENRGVR 150 LLYVGDHMF+DILRS RTLGWRTCL+VPELE+E+ + + +R Sbjct: 338 LLYVGDHMFSDILRSKRTLGWRTCLIVPELENEIATHNRHSELR 381
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: A0A7S1ULD4_9STRA (Hypothetical protein n=1 Tax=Grammatophora oceanica TaxID=210454 RepID=A0A7S1ULD4_9STRA) HSP 1 Score: 68.6 bits (166), Expect = 6.090e-12 Identity = 30/51 (58.82%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 1 VPATKHLLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANRENRGVRR 153 V A + +LYVGDH++AD+LRS RTLGWR+ +VPELE EM EN+ V R Sbjct: 395 VDAGEEILYVGDHLYADVLRSKRTLGWRSAFIVPELEEEMRVFDENKNVLR 445
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: A0A7S1ZFY4_TRICV (Hypothetical protein n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S1ZFY4_TRICV) HSP 1 Score: 68.6 bits (166), Expect = 6.100e-12 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 1 VPATKHLLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANRENRGVRR 153 V A + ++YVGDH++AD+LRS RTLGWR+C +VPEL EM RE +RR Sbjct: 445 VEAGEEIMYVGDHLYADVLRSKRTLGWRSCFIVPELAEEMRVFREQLPLRR 495
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Match: R7QL05_CHOCR (Cytosolic IMP-GMP specific 5'-nucleotidase n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7QL05_CHOCR) HSP 1 Score: 67.4 bits (163), Expect = 1.540e-11 Identity = 29/41 (70.73%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 1 VPATKHLLYVGDHMFADILRSTRTLGWRTCLVVPELESEMN 123 V + HLLYVGDH+F+D+LRS RTLGWRT L+VPELE E+N Sbjct: 282 VQSGTHLLYVGDHIFSDVLRSKRTLGWRTMLIVPELEHEIN 322 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7075.15880.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7075.15880.1 >prot_L-elsbetiae_contig7075.15880.1 ID=prot_L-elsbetiae_contig7075.15880.1|Name=mRNA_L-elsbetiae_contig7075.15880.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=66bp VPATKHLLYVGDHMFADILRSTRTLGWRTCLVVPELESEMNANRENRGVRback to top mRNA from alignment at L-elsbetiae_contig7075:296..493+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7075.15880.1 ID=mRNA_L-elsbetiae_contig7075.15880.1|Name=mRNA_L-elsbetiae_contig7075.15880.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=198bp|location=Sequence derived from alignment at L-elsbetiae_contig7075:296..493+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7075:296..493+ >mRNA_L-elsbetiae_contig7075.15880.1 ID=mRNA_L-elsbetiae_contig7075.15880.1|Name=mRNA_L-elsbetiae_contig7075.15880.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=396bp|location=Sequence derived from alignment at L-elsbetiae_contig7075:296..493+ (Laminarionema elsbetiae ELsaHSoW15)back to top |