mRNA_L-elsbetiae_contig546.13717.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig546.13717.1 vs. uniprot
Match: A0A6H5LQT4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LQT4_9PHAE) HSP 1 Score: 77.0 bits (188), Expect = 3.770e-14 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = 1 Query: 1 KAAGKLAVLLATEFPRPCCYLLVACLVGLFGLVSGVERGAPVAWI 135 +AA LAVLLATE PRPCCYL+VA L GLFGLVSGVERGAP+AWI Sbjct: 510 EAAAGLAVLLATECPRPCCYLVVAGLAGLFGLVSGVERGAPIAWI 554
BLAST of mRNA_L-elsbetiae_contig546.13717.1 vs. uniprot
Match: D8LQ07_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQ07_ECTSI) HSP 1 Score: 72.0 bits (175), Expect = 2.130e-12 Identity = 37/44 (84.09%), Postives = 39/44 (88.64%), Query Frame = 1 Query: 4 AAGKLAVLLATEFPRPCCYLLVACLVGLFGLVSGVERGAPVAWI 135 AAG LAVLLATE PRPCCYL+VA L GLFGLVS VERGAP+AWI Sbjct: 393 AAG-LAVLLATECPRPCCYLVVAGLAGLFGLVSEVERGAPIAWI 435 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig546.13717.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig546.13717.1 >prot_L-elsbetiae_contig546.13717.1 ID=prot_L-elsbetiae_contig546.13717.1|Name=mRNA_L-elsbetiae_contig546.13717.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=111bp KAAGKLAVLLATEFPRPCCYLLVACLVGLFGLVSGVERGAPVAWIGHTRPback to top mRNA from alignment at L-elsbetiae_contig546:16355..16687+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig546.13717.1 ID=mRNA_L-elsbetiae_contig546.13717.1|Name=mRNA_L-elsbetiae_contig546.13717.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=333bp|location=Sequence derived from alignment at L-elsbetiae_contig546:16355..16687+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig546:16355..16687+ >mRNA_L-elsbetiae_contig546.13717.1 ID=mRNA_L-elsbetiae_contig546.13717.1|Name=mRNA_L-elsbetiae_contig546.13717.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=666bp|location=Sequence derived from alignment at L-elsbetiae_contig546:16355..16687+ (Laminarionema elsbetiae ELsaHSoW15)back to top |