prot_L-elsbetiae_contig546.13717.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig546.13717.1 vs. uniprot
Match: A0A6H5LQT4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LQT4_9PHAE) HSP 1 Score: 77.0 bits (188), Expect = 3.770e-14 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = 0 Query: 1 KAAGKLAVLLATEFPRPCCYLLVACLVGLFGLVSGVERGAPVAWI 45 +AA LAVLLATE PRPCCYL+VA L GLFGLVSGVERGAP+AWI Sbjct: 510 EAAAGLAVLLATECPRPCCYLVVAGLAGLFGLVSGVERGAPIAWI 554
BLAST of mRNA_L-elsbetiae_contig546.13717.1 vs. uniprot
Match: D8LQ07_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQ07_ECTSI) HSP 1 Score: 72.0 bits (175), Expect = 2.130e-12 Identity = 37/44 (84.09%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 2 AAGKLAVLLATEFPRPCCYLLVACLVGLFGLVSGVERGAPVAWI 45 AAG LAVLLATE PRPCCYL+VA L GLFGLVS VERGAP+AWI Sbjct: 393 AAG-LAVLLATECPRPCCYLVVAGLAGLFGLVSEVERGAPIAWI 435 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig546.13717.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig546.13717.1 ID=prot_L-elsbetiae_contig546.13717.1|Name=mRNA_L-elsbetiae_contig546.13717.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=111bpback to top |