mRNA_L-elsbetiae_contig5443.13689.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Match: D7FH97_ECTSI (Similar to chromosome fragility associated gene 1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH97_ECTSI) HSP 1 Score: 71.2 bits (173), Expect = 2.410e-13 Identity = 30/38 (78.95%), Postives = 36/38 (94.74%), Query Frame = 1 Query: 13 QYDWIPYSDDD-DEDSRLCNMAMLCGPPGVGKTSAVYG 123 +YDW+ +SD++ DED+RLCNMAMLCGPPGVGKTSAVYG Sbjct: 857 EYDWVRFSDEEEDEDARLCNMAMLCGPPGVGKTSAVYG 894
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Match: A0A8D0BEM7_9SAUR (ATPase_AAA_core domain-containing protein n=1 Tax=Salvator merianae TaxID=96440 RepID=A0A8D0BEM7_9SAUR) HSP 1 Score: 47.4 bits (111), Expect = 6.410e-5 Identity = 19/34 (55.88%), Postives = 25/34 (73.53%), Query Frame = 1 Query: 19 DWIPYSDDDDEDSRLCNMAMLCGPPGVGKTSAVY 120 D+ Y D +E+S LCN +L GPPG+GKT+AVY Sbjct: 780 DFKDYGSDSEEESVLCNTVLLTGPPGIGKTAAVY 813
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Match: F6ZIX7_MONDO (AAA domain-containing protein n=3 Tax=Didelphinae TaxID=126287 RepID=F6ZIX7_MONDO) HSP 1 Score: 47.0 bits (110), Expect = 8.760e-5 Identity = 22/40 (55.00%), Postives = 28/40 (70.00%), Query Frame = 1 Query: 1 DNKYQYDWIPYSDDDDEDSRLCNMAMLCGPPGVGKTSAVY 120 D + D+ SDD+DE S LCN ++ GPPGVGKT+AVY Sbjct: 1138 DLSFSMDFKDLSDDEDESS-LCNTVLITGPPGVGKTAAVY 1176 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5443.13689.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5443.13689.1 >prot_L-elsbetiae_contig5443.13689.1 ID=prot_L-elsbetiae_contig5443.13689.1|Name=mRNA_L-elsbetiae_contig5443.13689.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=42bp DNKYQYDWIPYSDDDDEDSRLCNMAMLCGPPGVGKTSAVYG*back to top mRNA from alignment at L-elsbetiae_contig5443:505..630- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5443.13689.1 ID=mRNA_L-elsbetiae_contig5443.13689.1|Name=mRNA_L-elsbetiae_contig5443.13689.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=126bp|location=Sequence derived from alignment at L-elsbetiae_contig5443:505..630- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5443:505..630- >mRNA_L-elsbetiae_contig5443.13689.1 ID=mRNA_L-elsbetiae_contig5443.13689.1|Name=mRNA_L-elsbetiae_contig5443.13689.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=252bp|location=Sequence derived from alignment at L-elsbetiae_contig5443:505..630- (Laminarionema elsbetiae ELsaHSoW15)back to top |