prot_L-elsbetiae_contig5072.13102.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5072.13102.1 vs. uniprot
Match: A0A7S2W840_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2W840_9STRA) HSP 1 Score: 67.4 bits (163), Expect = 6.540e-11 Identity = 27/74 (36.49%), Postives = 49/74 (66.22%), Query Frame = 0 Query: 1 MLPVLAALKIYDGNWPPYSSYISFDVAEDEGGQRLVRVVFNGKEAVLPGAEGAWIPLTELRERLEDVMPTPEDL 74 ++PVL +L +DG WPP++SY+SF++ E + G+ +RV++NGK V+ G A L + R+ ++ + P+ D+ Sbjct: 312 VVPVLTSLGQFDGVWPPFASYVSFELWESKDGRHSIRVLYNGKPLVVSGCHSARCSLEDFRQAMQSIRPSNYDM 385
BLAST of mRNA_L-elsbetiae_contig5072.13102.1 vs. uniprot
Match: A0A7R9U2J4_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9U2J4_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 2.870e-10 Identity = 30/74 (40.54%), Postives = 46/74 (62.16%), Query Frame = 0 Query: 1 MLPVLAALKIYDGNWPPYSSYISFDVAEDEGGQRLVRVVFNGKEAVLPGAE----GAWIPLTELRERLEDVMPT 70 ++P+LA L +YDG WP YSS++SF+VAE G+ L RVV+N + L G G W+ +L+ L+ +P+ Sbjct: 91 LVPLLAVLGVYDGAWPGYSSFVSFEVAEGPDGKVLARVVYNNEAQALSGIAKEDPGHWVSWEDLKAGLQKWIPS 164
BLAST of mRNA_L-elsbetiae_contig5072.13102.1 vs. uniprot
Match: A0A5J4Z3E9_PORPP (Lysophosphatidic acid phosphatase type 6 n=1 Tax=Porphyridium purpureum TaxID=35688 RepID=A0A5J4Z3E9_PORPP) HSP 1 Score: 53.9 bits (128), Expect = 3.670e-6 Identity = 24/71 (33.80%), Postives = 44/71 (61.97%), Query Frame = 0 Query: 1 MLPVLAALKIYDGNWPPYSSYISFDVAEDEG--GQRLVRVVFNGKEAVLPGAEGAWIPLTELRERLEDVMP 69 ++P+L AL+++DG WPP+++Y++ ++ E++ G VRVV+NG+E +L R+ DV+P Sbjct: 333 LVPILVALRVFDGKWPPFAAYVAIELLENQQNRGSFFVRVVYNGEEQLLED-------FASFERRVCDVIP 396
BLAST of mRNA_L-elsbetiae_contig5072.13102.1 vs. uniprot
Match: A0A7S0H2A6_9EUKA (Hypothetical protein n=1 Tax=Amorphochlora amoebiformis TaxID=1561963 RepID=A0A7S0H2A6_9EUKA) HSP 1 Score: 52.8 bits (125), Expect = 9.550e-6 Identity = 24/55 (43.64%), Postives = 38/55 (69.09%), Query Frame = 0 Query: 1 MLPVLAALKIYDGNWPPYSSYISFDVAED-EGGQRLVRVVFNGKEAVLPGAEGAW 54 ++P+LAAL +Y+G WPPY+SYI ++AE + G VRV +N +E ++ +G W Sbjct: 419 LVPLLAALGVYEGQWPPYASYIVIELAESTKTGDHWVRVQYNNEELLM--MDGFW 471
BLAST of mRNA_L-elsbetiae_contig5072.13102.1 vs. uniprot
Match: A0A7S0SR77_9STRA (Hypothetical protein n=2 Tax=Chromulina nebulosa TaxID=96789 RepID=A0A7S0SR77_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 1.240e-5 Identity = 20/68 (29.41%), Postives = 42/68 (61.76%), Query Frame = 0 Query: 1 MLPVLAALKIYDGNWPPYSSYISFDVAEDEGGQ-RLVRVVFNGKEAVLPGAEGAWIPLTELRERLEDV 67 ++P++ AL +YD WPPY+SY+SF++ ++ + VR ++N ++ + G W+ + +RL+ + Sbjct: 15 LVPLMCALGLYDDVWPPYASYLSFEIVTNKYSNIKYVRAIYNDEDRNMLGRSQTWLLYSTFIDRLKQM 82 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5072.13102.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5072.13102.1 ID=prot_L-elsbetiae_contig5072.13102.1|Name=mRNA_L-elsbetiae_contig5072.13102.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=105bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|