prot_L-elsbetiae_contig502.13034.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig502.13034.1 vs. uniprot
Match: A0A6H5JPW3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPW3_9PHAE) HSP 1 Score: 119 bits (298), Expect = 1.970e-30 Identity = 62/102 (60.78%), Postives = 75/102 (73.53%), Query Frame = 0 Query: 14 GLLFRPTKARAKKVRQNVEGLWIIYQAKLLHPLDLDRWTEIFETTVSSLLSTQPLQSLTKRARLGVVMSIVGSGRTHLHTPAVLAVLATDWSDEWASFKLLQ 115 G F PT+ + + RQ +E L+ ++QAKLLHPLD RWT + TTV+SLLS QPLQ LTK RL V+M IVGSGR L +PAVLAVLA DW D++ SFKLLQ Sbjct: 62 GGAFLPTEFQMR--RQELEELFTVWQAKLLHPLDRSRWTNVLNTTVASLLSAQPLQCLTKSGRLAVMMCIVGSGRAGLFSPAVLAVLACDWVDDYGSFKLLQ 161 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig502.13034.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig502.13034.1 ID=prot_L-elsbetiae_contig502.13034.1|Name=mRNA_L-elsbetiae_contig502.13034.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=217bpback to top |