mRNA_L-elsbetiae_contig2116.6447.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2116.6447.1 vs. uniprot
Match: D7FUI7_ECTSI (Sept3, septin GTPase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUI7_ECTSI) HSP 1 Score: 50.1 bits (118), Expect = 1.630e-5 Identity = 32/65 (49.23%), Postives = 35/65 (53.85%), Query Frame = 1 Query: 1 MPPNTSCDPASGAGAVPCELPDTKGRR-----GSLTSSRVPGDPSPQKLPDQLRVMVAGESGLGK 180 MPPNT+ G PC G G+ S RVPG P + PDQLRVMVAGESGLGK Sbjct: 1 MPPNTT------VGTDPCMASPVVGDPQAKDGGNAPSVRVPGPPQQRPTPDQLRVMVAGESGLGK 59
BLAST of mRNA_L-elsbetiae_contig2116.6447.1 vs. uniprot
Match: A0A6H5JBY2_9PHAE (Septin-type G domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JBY2_9PHAE) HSP 1 Score: 48.1 bits (113), Expect = 7.820e-5 Identity = 30/61 (49.18%), Postives = 34/61 (55.74%), Query Frame = 1 Query: 1 MPPNTSCDPASGAGAVPCELPDTKGRRGSLTSSRVPGDPSPQKLPDQLRVMVAGESGLGKA 183 MPP+T+ SG G+ S RVPG P + PDQLRVMVAGESGLGKA Sbjct: 1 MPPSTAMASDSGMGSPVVGA-----------SVRVPGPPQQSQAPDQLRVMVAGESGLGKA 50 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2116.6447.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig2116.6447.1 >prot_L-elsbetiae_contig2116.6447.1 ID=prot_L-elsbetiae_contig2116.6447.1|Name=mRNA_L-elsbetiae_contig2116.6447.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=61bp MPPNTSCDPASGAGAVPCELPDTKGRRGSLTSSRVPGDPSPQKLPDQLRVback to top mRNA from alignment at L-elsbetiae_contig2116:13632..13814- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig2116.6447.1 ID=mRNA_L-elsbetiae_contig2116.6447.1|Name=mRNA_L-elsbetiae_contig2116.6447.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=183bp|location=Sequence derived from alignment at L-elsbetiae_contig2116:13632..13814- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig2116:13632..13814- >mRNA_L-elsbetiae_contig2116.6447.1 ID=mRNA_L-elsbetiae_contig2116.6447.1|Name=mRNA_L-elsbetiae_contig2116.6447.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=366bp|location=Sequence derived from alignment at L-elsbetiae_contig2116:13632..13814- (Laminarionema elsbetiae ELsaHSoW15)back to top |