mRNA_L-elsbetiae_contig2112.6432.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2112.6432.1 vs. uniprot
Match: D7FH78_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH78_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 8.240e-10 Identity = 28/41 (68.29%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 148 LAQFVPDKQFLFFAPVCRSWRAAWGHRPALTSHVSPDSSLS 270 LAQFVPD QFLFFAPV + WRAAW RP +T+HV+PD++ S Sbjct: 119 LAQFVPDNQFLFFAPVAKGWRAAW-QRPTITAHVTPDTTTS 158
BLAST of mRNA_L-elsbetiae_contig2112.6432.1 vs. uniprot
Match: A0A6H5KPZ6_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KPZ6_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 2.190e-9 Identity = 28/42 (66.67%), Postives = 35/42 (83.33%), Query Frame = 1 Query: 145 SLAQFVPDKQFLFFAPVCRSWRAAWGHRPALTSHVSPDSSLS 270 S+ +FV +KQFLFFAPV R+WR AWG RPA+TS V+ DSS+S Sbjct: 66 SIVRFVAEKQFLFFAPVSRAWREAWGCRPAVTSWVTEDSSVS 107
BLAST of mRNA_L-elsbetiae_contig2112.6432.1 vs. uniprot
Match: D8LGC4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LGC4_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 2.020e-8 Identity = 25/41 (60.98%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 148 LAQFVPDKQFLFFAPVCRSWRAAWGHRPALTSHVSPDSSLS 270 +A+FV DKQ+LFFAPV + WR+AWG RP +TS+ +P +SLS Sbjct: 1 MAEFVGDKQYLFFAPVSQDWRSAWGGRPTVTSYATPYTSLS 41
BLAST of mRNA_L-elsbetiae_contig2112.6432.1 vs. uniprot
Match: D7FH49_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH49_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 4.530e-7 Identity = 26/36 (72.22%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 148 LAQFVPDKQFLFFAPVCRSWRAAWGHRPALTSHVSP 255 LAQFV DKQFLFFA V RSWR AWG R +TS V+P Sbjct: 29 LAQFVLDKQFLFFAAVSRSWRDAWGERATVTSWVTP 64
BLAST of mRNA_L-elsbetiae_contig2112.6432.1 vs. uniprot
Match: D7FH77_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FH77_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 2.630e-6 Identity = 22/37 (59.46%), Postives = 25/37 (67.57%), Query Frame = 1 Query: 148 LAQFVPDKQFLFFAPVCRSWRAAWGHRPALTSHVSPD 258 L FV D+ FLFF PVCR WRAAWG+RP T + D Sbjct: 19 LISFVADESFLFFGPVCRDWRAAWGNRPTTTRIATSD 55
BLAST of mRNA_L-elsbetiae_contig2112.6432.1 vs. uniprot
Match: A0A6H5L0J7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0J7_9PHAE) HSP 1 Score: 49.7 bits (117), Expect = 4.810e-5 Identity = 20/41 (48.78%), Postives = 29/41 (70.73%), Query Frame = 1 Query: 145 SLAQFVPDKQFLFFAPVCRSWRAAWGHRPALTSHVSPDSSL 267 ++A+FV D Q+LFFA V R WR WG RP +T ++ D+S+ Sbjct: 12 TVAEFVDDNQYLFFASVSRGWRDVWGKRPTVTKALTADTSV 52 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2112.6432.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig2112.6432.1 >prot_L-elsbetiae_contig2112.6432.1 ID=prot_L-elsbetiae_contig2112.6432.1|Name=mRNA_L-elsbetiae_contig2112.6432.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=81bp MTNAAALRSSTSTGVGSPAESEQEQEGSSSAMTNATALRSLAQFVPDKQFback to top mRNA from alignment at L-elsbetiae_contig2112:15244..15513+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig2112.6432.1 ID=mRNA_L-elsbetiae_contig2112.6432.1|Name=mRNA_L-elsbetiae_contig2112.6432.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=270bp|location=Sequence derived from alignment at L-elsbetiae_contig2112:15244..15513+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig2112:15244..15513+ >mRNA_L-elsbetiae_contig2112.6432.1 ID=mRNA_L-elsbetiae_contig2112.6432.1|Name=mRNA_L-elsbetiae_contig2112.6432.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=486bp|location=Sequence derived from alignment at L-elsbetiae_contig2112:15244..15513+ (Laminarionema elsbetiae ELsaHSoW15)back to top |