mRNA_L-elsbetiae_contig19859.5941.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19859.5941.1 vs. uniprot
Match: A0A8J5FX94_ZINOF (Uncharacterized protein n=1 Tax=Zingiber officinale TaxID=94328 RepID=A0A8J5FX94_ZINOF) HSP 1 Score: 50.1 bits (118), Expect = 3.060e-5 Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1 Query: 4 CARVKGRRASVPKKGGRATSPCSTLHLDLCGGLYP-SIAGSIYLLAVVDNFSRLLLTYGLRRKSDA 198 C K R PK RA SP +H+D+CG + S+ Y + VD+F+R++ TY L RKSDA Sbjct: 486 CIYRKMHRFPFPKTAWRARSPLELVHVDICGPIRSASLGNKQYFILFVDDFTRMIWTYFLDRKSDA 551
BLAST of mRNA_L-elsbetiae_contig19859.5941.1 vs. uniprot
Match: A0A4Y2K047_ARAVE (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=2 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2K047_ARAVE) HSP 1 Score: 49.7 bits (117), Expect = 3.680e-5 Identity = 27/66 (40.91%), Postives = 41/66 (62.12%), Query Frame = 1 Query: 1 PCARVKGRRASVPKKGG-RATSPCSTLHLDLCGGLYP-SIAGSIYLLAVVDNFSRLLLTYGLRRKS 192 PC K +R S G R+T+P LHLD+CG L SI G Y L+++D++SR + T+ ++RK+ Sbjct: 105 PCRLAKSKRHSFKPIGKIRSTNPLELLHLDVCGPLPSNSIQGHRYFLSIIDDYSRKVTTFPMKRKT 170
BLAST of mRNA_L-elsbetiae_contig19859.5941.1 vs. uniprot
Match: A0A8J5I781_ZINOF (Integrase catalytic domain-containing protein n=3 Tax=Zingiber officinale TaxID=94328 RepID=A0A8J5I781_ZINOF) HSP 1 Score: 49.3 bits (116), Expect = 5.740e-5 Identity = 27/66 (40.91%), Postives = 36/66 (54.55%), Query Frame = 1 Query: 4 CARVKGRRASVPKKGGRATSPCSTLHLDLCGGLYP-SIAGSIYLLAVVDNFSRLLLTYGLRRKSDA 198 C K R PK RA SP +H D+CG + S+ Y + VD+F+R++ TY L RKSDA Sbjct: 513 CIYGKMHRFPFPKTAWRARSPLELVHADICGPIRSASLGNKQYFILFVDDFTRMIWTYFLDRKSDA 578 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19859.5941.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig19859.5941.1 >prot_L-elsbetiae_contig19859.5941.1 ID=prot_L-elsbetiae_contig19859.5941.1|Name=mRNA_L-elsbetiae_contig19859.5941.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=76bp PCARVKGRRASVPKKGGRATSPCSTLHLDLCGGLYPSIAGSIYLLAVVDNback to top mRNA from alignment at L-elsbetiae_contig19859:2411..2638+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig19859.5941.1 ID=mRNA_L-elsbetiae_contig19859.5941.1|Name=mRNA_L-elsbetiae_contig19859.5941.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=228bp|location=Sequence derived from alignment at L-elsbetiae_contig19859:2411..2638+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig19859:2411..2638+ >mRNA_L-elsbetiae_contig19859.5941.1 ID=mRNA_L-elsbetiae_contig19859.5941.1|Name=mRNA_L-elsbetiae_contig19859.5941.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=456bp|location=Sequence derived from alignment at L-elsbetiae_contig19859:2411..2638+ (Laminarionema elsbetiae ELsaHSoW15)back to top |