prot_L-elsbetiae_contig19667.5862.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19667.5862.1 vs. uniprot
Match: D7FQI6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQI6_ECTSI) HSP 1 Score: 91.3 bits (225), Expect = 3.920e-20 Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 0 Query: 60 PVVTVPKKAEMAPPSKEDVLSPKHAEDVLVVGKGVVLTANVTSCDKVIVEGKFQGNIKTDTFVLTEG 126 PV+ E P KEDVL+ KH E VLVVGKGVVLTANVTSCDKV+VEG FQGNIKT TFVL+EG Sbjct: 70 PVIAASTPQEEKMPDKEDVLAAKHEERVLVVGKGVVLTANVTSCDKVVVEGNFQGNIKTGTFVLSEG 136
BLAST of mRNA_L-elsbetiae_contig19667.5862.1 vs. uniprot
Match: A0A6H5JYZ3_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYZ3_9PHAE) HSP 1 Score: 85.5 bits (210), Expect = 3.970e-17 Identity = 42/54 (77.78%), Postives = 48/54 (88.89%), Query Frame = 0 Query: 73 PSKEDVLSPKHAEDVLVVGKGVVLTANVTSCDKVIVEGKFQGNIKTDTFVLTEG 126 P++E VL+ KH E VLVVGKGVVLTANVTSCDKV+VEG FQGNI+T TFVL+EG Sbjct: 209 PAEEGVLAAKHEERVLVVGKGVVLTANVTSCDKVVVEGNFQGNIETGTFVLSEG 262 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19667.5862.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19667.5862.1 ID=prot_L-elsbetiae_contig19667.5862.1|Name=mRNA_L-elsbetiae_contig19667.5862.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=134bpback to top |