prot_L-elsbetiae_contig19555.5821.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19555.5821.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 4
ZOOM
x 1
POSITION
0
WETDRRDRTALFWAAGGGSVDACMALVEGEGGLRPRDSGGDGSTPLHWAAAGVETRRFGTGGHVNVRLCLFLCP*10203040506070Expect = 1.43e-35 / Id = 92.42Expect = 1.85e-35 / Id = 92.42Expect = 3.60e-7 / Id = 46.38Expect = 1.10e-5 / Id = 43.66SequenceD8LGD8_ECTSIA0A6H5KU03_9PHAEB7FSM1_PHATCR1CVS8_EMIHU
Match NameE-valueIdentityDescription
D8LGD8_ECTSI1.430e-3592.42Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
A0A6H5KU03_9PHAE1.850e-3592.42Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
B7FSM1_PHATC3.600e-746.38Predicted protein n=1 Tax=Phaeodactylum tricornutu... [more]
R1CVS8_EMIHU1.100e-543.66Uncharacterized protein n=2 Tax=Emiliania huxleyi ... [more]
back to top