prot_L-elsbetiae_contig18890.5548.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig18890.5548.1 vs. uniprot
Match: D7FNX7_ECTSI (TatD DNase domain containing 3 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNX7_ECTSI) HSP 1 Score: 58.9 bits (141), Expect = 6.710e-9 Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 0 Query: 1 MFDCHAHLTDPYFREGIDEALAQAEDVGVVGIIAVSETSEDAVKV 45 MFDCHAHLTD EG+ + L +AE GV GI+AVSE+ +DA V Sbjct: 1 MFDCHAHLTDSSLAEGLQQTLLEAEAAGVTGIVAVSESLDDATPV 45
BLAST of mRNA_L-elsbetiae_contig18890.5548.1 vs. uniprot
Match: A0A6H5KIS3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIS3_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 1.170e-8 Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 0 Query: 1 MFDCHAHLTDPYFREGIDEALAQAEDVGVVGIIAVSETSEDAVKV 45 MFDCHAHLTD EG+ + L +AE GV GI+AVSE+ +DA V Sbjct: 46 MFDCHAHLTDSSLAEGLHQTLLEAEAAGVTGIVAVSESLDDATPV 90 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18890.5548.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig18890.5548.1 ID=prot_L-elsbetiae_contig18890.5548.1|Name=mRNA_L-elsbetiae_contig18890.5548.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=54bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|