mRNA_L-elsbetiae_contig1849.5375.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1849.5375.1 vs. uniprot
Match: A0A7S2CD11_9STRA (Hypothetical protein (Fragment) n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2CD11_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 1.980e-9 Identity = 27/58 (46.55%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 13 EFLKEEGRTAEDLFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFYRLMLTAA 186 +FL+ EG ++ + ++ KDA E+NYTALFEEH++H FV ++L +M Y+ F+ +M AA Sbjct: 96 QFLEGEGCSSAEFYAQCKDAIEDNYTALFEEHQHHWFVDALLASMSYEHFFEMMTKAA 153
BLAST of mRNA_L-elsbetiae_contig1849.5375.1 vs. uniprot
Match: A0A7S4A6K5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S4A6K5_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 4.820e-8 Identity = 27/62 (43.55%), Postives = 40/62 (64.52%), Query Frame = 1 Query: 1 ATTSEFLKEEGRTAEDLFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFYRLMLTAA 186 A FL E+ + ++ + ++DA E+ Y ALFEEHE+HG+V S A+ Y+ FYR M+ AA Sbjct: 81 AAIEAFLSEKAFSLQEFQAQLRDAVEDRYCALFEEHEHHGWVDSCFAAVSYEHFYRRMVAAA 142
BLAST of mRNA_L-elsbetiae_contig1849.5375.1 vs. uniprot
Match: A0A7S2SCS0_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SCS0_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 8.800e-7 Identity = 24/58 (41.38%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 13 EFLKEEGRTAEDLFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFYRLMLTAA 186 +FL+ +G ++ D FS +DA E+ + LFEEH +H FV ++L +M Y+ F+ M AA Sbjct: 89 DFLRTQGCSSADFFSQCRDALEDRFVPLFEEHHHHWFVDALLSSMSYEHFFSSMCEAA 146
BLAST of mRNA_L-elsbetiae_contig1849.5375.1 vs. uniprot
Match: A0A7S3JYZ2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3JYZ2_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 5.530e-6 Identity = 23/54 (42.59%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 13 EFLKEEGRTAEDLFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFYRLM 174 +FL + + LF M+DAK + YTALFEEH++H +V S+L + ++ F +LM Sbjct: 88 DFLHHQSLSMSQLFEQMEDAKLDRYTALFEEHQHHAWVDSILAVLSFEYFVQLM 141 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1849.5375.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1849.5375.1 >prot_L-elsbetiae_contig1849.5375.1 ID=prot_L-elsbetiae_contig1849.5375.1|Name=mRNA_L-elsbetiae_contig1849.5375.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=62bp ATTSEFLKEEGRTAEDLFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEback to top mRNA from alignment at L-elsbetiae_contig1849:17406..18220- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1849.5375.1 ID=mRNA_L-elsbetiae_contig1849.5375.1|Name=mRNA_L-elsbetiae_contig1849.5375.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=815bp|location=Sequence derived from alignment at L-elsbetiae_contig1849:17406..18220- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1849:17406..18220- >mRNA_L-elsbetiae_contig1849.5375.1 ID=mRNA_L-elsbetiae_contig1849.5375.1|Name=mRNA_L-elsbetiae_contig1849.5375.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=372bp|location=Sequence derived from alignment at L-elsbetiae_contig1849:17406..18220- (Laminarionema elsbetiae ELsaHSoW15)back to top |