prot_L-elsbetiae_contig18249.5277.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig18249.5277.1 vs. uniprot
Match: A0A6H5L0N8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0N8_9PHAE) HSP 1 Score: 100 bits (250), Expect = 1.700e-23 Identity = 44/54 (81.48%), Postives = 52/54 (96.30%), Query Frame = 0 Query: 1 SSADVCLLSGVLCLHEWLRRVSLDGNPIDEEGLGFLCRALLKNGSIQSVSLNRC 54 S+ADVCLL+GV+CLH+WLRRV LDGNPIDEEGLG+L RALL+NGS+Q+VSLNRC Sbjct: 426 STADVCLLAGVICLHDWLRRVCLDGNPIDEEGLGYLSRALLRNGSVQTVSLNRC 479
BLAST of mRNA_L-elsbetiae_contig18249.5277.1 vs. uniprot
Match: D7FM61_ECTSI (Hypothetical leucine rich repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FM61_ECTSI) HSP 1 Score: 100 bits (250), Expect = 1.700e-23 Identity = 44/54 (81.48%), Postives = 52/54 (96.30%), Query Frame = 0 Query: 1 SSADVCLLSGVLCLHEWLRRVSLDGNPIDEEGLGFLCRALLKNGSIQSVSLNRC 54 S+ADVCLL+GV+CLH+WLRRV LDGNPIDEEGLG+L RALL+NGS+Q+VSLNRC Sbjct: 502 STADVCLLAGVICLHDWLRRVCLDGNPIDEEGLGYLSRALLRNGSVQTVSLNRC 555 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18249.5277.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig18249.5277.1 ID=prot_L-elsbetiae_contig18249.5277.1|Name=mRNA_L-elsbetiae_contig18249.5277.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=56bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|