prot_L-elsbetiae_contig1821.5261.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1821.5261.1 vs. uniprot
Match: A0A6H5L473_9PHAE (AAA_11 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L473_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 5.990e-11 Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 15 VEKAGGMQPGGAAGGLRISGCARGGDAEWSRITMAQSRIPRPECSREDIAHVVAEVTAMAGLSKVQS 81 V+KAGG+QPG G + DAEW+RI + SR PRPECSR DIA++VA VTA AGLSK ++ Sbjct: 179 VKKAGGVQPG--VGDTALPQGVVAPDAEWARIALGLSRFPRPECSRGDIANIVAGVTAEAGLSKTRA 243
BLAST of mRNA_L-elsbetiae_contig1821.5261.1 vs. uniprot
Match: D7FK70_ECTSI (tRNA-splicing endonuclease positive effector n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK70_ECTSI) HSP 1 Score: 67.4 bits (163), Expect = 1.560e-10 Identity = 37/69 (53.62%), Postives = 48/69 (69.57%), Query Frame = 0 Query: 15 VEKAGGMQPGGAAGGLRISGCARGGDAEWSRITMAQSRIPRPECSREDIAHVVAEVTAMAGLSKVQSQS 83 +E+AGG+QPG G + DAEW+RI + SR P PECSR +IA+VVA VTA AGLSKVQ+++ Sbjct: 192 MERAGGVQPG--VGDTALPQGVVAPDAEWARIALGLSRFPGPECSRGNIANVVAGVTAEAGLSKVQTRA 258 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1821.5261.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1821.5261.1 ID=prot_L-elsbetiae_contig1821.5261.1|Name=mRNA_L-elsbetiae_contig1821.5261.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=127bpback to top |