prot_L-elsbetiae_contig9593.18565.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9593.18565.1 vs. uniprot
Match: A0A6H5JL89_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JL89_9PHAE) HSP 1 Score: 95.9 bits (237), Expect = 1.740e-24 Identity = 45/61 (73.77%), Postives = 52/61 (85.25%), Query Frame = 0 Query: 1 MDHWVAVGQKLTAEKHLADEVKKKVLVTRVNESLRRLLDDISEDNWMYDPTDLGQGNQHWR 61 MDHW VG+KLTAEKHLA++ KK VLV+ + SLRRL+DDISEDNWMYDP DLGQG+QH R Sbjct: 35 MDHWALVGEKLTAEKHLAEDAKK-VLVSDIKSSLRRLMDDISEDNWMYDPIDLGQGHQHGR 94
BLAST of mRNA_L-elsbetiae_contig9593.18565.1 vs. uniprot
Match: D7FQD5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQD5_ECTSI) HSP 1 Score: 93.6 bits (231), Expect = 5.690e-24 Identity = 44/61 (72.13%), Postives = 51/61 (83.61%), Query Frame = 0 Query: 1 MDHWVAVGQKLTAEKHLADEVKKKVLVTRVNESLRRLLDDISEDNWMYDPTDLGQGNQHWR 61 MDHW VG+KLTAEKHLA++ KK VLV+ + SLRRL+DDISEDNWMYDP DLGQG+ H R Sbjct: 1 MDHWALVGEKLTAEKHLAEDAKK-VLVSDIKSSLRRLMDDISEDNWMYDPIDLGQGHPHGR 60 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9593.18565.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9593.18565.1 ID=prot_L-elsbetiae_contig9593.18565.1|Name=mRNA_L-elsbetiae_contig9593.18565.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=62bpback to top |