mRNA_L-elsbetiae_contig9593.18565.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9593.18565.1 vs. uniprot
Match: A0A6H5JL89_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JL89_9PHAE) HSP 1 Score: 107 bits (266), Expect = 9.650e-29 Identity = 52/70 (74.29%), Postives = 59/70 (84.29%), Query Frame = 2 Query: 2 GKGEAEAQSMDHWVAVGQKLTAEKHLADEVKKKVLVTRVNESLRRLLDDISEDNWMYDPTDLGQGNQHWR 211 GKGEAEA MDHW VG+KLTAEKHLA++ KK VLV+ + SLRRL+DDISEDNWMYDP DLGQG+QH R Sbjct: 26 GKGEAEAHGMDHWALVGEKLTAEKHLAEDAKK-VLVSDIKSSLRRLMDDISEDNWMYDPIDLGQGHQHGR 94
BLAST of mRNA_L-elsbetiae_contig9593.18565.1 vs. uniprot
Match: D7FQD5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQD5_ECTSI) HSP 1 Score: 92.8 bits (229), Expect = 1.670e-23 Identity = 44/61 (72.13%), Postives = 51/61 (83.61%), Query Frame = 2 Query: 29 MDHWVAVGQKLTAEKHLADEVKKKVLVTRVNESLRRLLDDISEDNWMYDPTDLGQGNQHWR 211 MDHW VG+KLTAEKHLA++ KK VLV+ + SLRRL+DDISEDNWMYDP DLGQG+ H R Sbjct: 1 MDHWALVGEKLTAEKHLAEDAKK-VLVSDIKSSLRRLMDDISEDNWMYDPIDLGQGHPHGR 60 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9593.18565.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig9593.18565.1 >prot_L-elsbetiae_contig9593.18565.1 ID=prot_L-elsbetiae_contig9593.18565.1|Name=mRNA_L-elsbetiae_contig9593.18565.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=62bp MDHWVAVGQKLTAEKHLADEVKKKVLVTRVNESLRRLLDDISEDNWMYDPback to top mRNA from alignment at L-elsbetiae_contig9593:620..1585+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig9593.18565.1 ID=mRNA_L-elsbetiae_contig9593.18565.1|Name=mRNA_L-elsbetiae_contig9593.18565.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=966bp|location=Sequence derived from alignment at L-elsbetiae_contig9593:620..1585+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig9593:620..1585+ >mRNA_L-elsbetiae_contig9593.18565.1 ID=mRNA_L-elsbetiae_contig9593.18565.1|Name=mRNA_L-elsbetiae_contig9593.18565.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=372bp|location=Sequence derived from alignment at L-elsbetiae_contig9593:620..1585+ (Laminarionema elsbetiae ELsaHSoW15)back to top |