prot_L-elsbetiae_contig9561.18547.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9561.18547.1 vs. uniprot
Match: A0A6H5JST9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JST9_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 1.100e-11 Identity = 39/88 (44.32%), Postives = 56/88 (63.64%), Query Frame = 0 Query: 4 VGTDLILRAARDLEGGLRGALEHAGDLAGMEALYEKSGAEITIDHDQVRAGAQVFEATVGECNNQDRSFHQKYSDLLTARVHRAARAA 91 VG +L A+ + GGL L A L +E L + G +++I+ + GA+V EAT+GECNN D SFHQ +DL TA++HRA++AA Sbjct: 66 VGIVKMLAASSETPGGLPAVLREAEGLRDLEVLVKNLGGDLSINLLN-QEGAEVLEATIGECNNGDGSFHQPGADLKTAKIHRASQAA 152 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9561.18547.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9561.18547.1 ID=prot_L-elsbetiae_contig9561.18547.1|Name=mRNA_L-elsbetiae_contig9561.18547.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=132bpback to top |