prot_L-elsbetiae_contig9547.18534.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9547.18534.1 vs. uniprot
Match: A0A833V713_9POAL (Putative leucine-rich repeat receptor-like protein kinase n=1 Tax=Carex littledalei TaxID=544730 RepID=A0A833V713_9POAL) HSP 1 Score: 57.0 bits (136), Expect = 2.660e-6 Identity = 47/136 (34.56%), Postives = 73/136 (53.68%), Query Frame = 0 Query: 1 LAGPIPQELGNLRELQTLWLNRNQLTALVSTKFHNSRDIFCSTL--LNCPALTRSS-AGNIPPQLGQLGALEFLNLANNKLDGELNRSKSDFLSIF-ILNTDELVLAL-PLAGSIPPELGNLAALKTLYLDQNQLS 131 + G + +E+GNL++L+ L L+ N K + + S L LN AL ++ G IPP LG+L L +L+LA+N+L G L S D + +L L+L L G IP +G + AL+ + LD N+L+ Sbjct: 3 IQGTLSEEIGNLKQLRILDLSSNM-------KLGGTLPVTLSNLVHLNNLALNVNNFTGKIPPSLGKLSKLTWLDLADNQLSGALPISAKDGWGLDQLLKAKHLLLDRNQLKGPIPKSIGLVQALEVIRLDNNRLT 131 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9547.18534.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9547.18534.1 ID=prot_L-elsbetiae_contig9547.18534.1|Name=mRNA_L-elsbetiae_contig9547.18534.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=180bpback to top |