prot_L-elsbetiae_contig8544.17578.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: D8LN84_ECTSI (Ribosomal protein rpl30 n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LN84_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 1.290e-8 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0 Query: 25 GAQNKKAIESMNARLQLVMKSGKASLGYKSTI 56 G ++KKAIESMNARLQLVMKSGKASLGYKSTI Sbjct: 4 GKKSKKAIESMNARLQLVMKSGKASLGYKSTI 35
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: A0A8C6XDP1_NAJNA (60S ribosomal protein L30 n=2 Tax=Naja naja TaxID=35670 RepID=A0A8C6XDP1_NAJNA) HSP 1 Score: 50.1 bits (118), Expect = 3.970e-6 Identity = 24/35 (68.57%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 22 FVVGAQNKKAIESMNARLQLVMKSGKASLGYKSTI 56 FV A+NKK++ES+N+RLQLVMKSGK LGYK T+ Sbjct: 26 FVAAAKNKKSLESINSRLQLVMKSGKYVLGYKQTL 60
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: A0A7S2AKD1_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2AKD1_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 7.120e-6 Identity = 23/32 (71.88%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 25 GAQNKKAIESMNARLQLVMKSGKASLGYKSTI 56 G ++K+A+ES+N+RLQLVMKSGKA LGYKST+ Sbjct: 26 GKKSKRAVESINSRLQLVMKSGKAELGYKSTL 57
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: W7T0G1_9STRA (Ribosomal protein l30 n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7T0G1_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 7.240e-6 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = 0 Query: 27 QNKKAIESMNARLQLVMKSGKASLGYKSTI 56 ++KKAIES+N+RLQLVMKSGKASLGYK T+ Sbjct: 33 KSKKAIESINSRLQLVMKSGKASLGYKETL 62
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: A0A812PA55_SYMMI (RPL30 protein n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A812PA55_SYMMI) HSP 1 Score: 48.5 bits (114), Expect = 9.530e-6 Identity = 23/32 (71.88%), Postives = 29/32 (90.62%), Query Frame = 0 Query: 25 GAQNKKAIESMNARLQLVMKSGKASLGYKSTI 56 G + KK +ES+N+RLQLVM+SGKASLGYK+TI Sbjct: 6 GKKTKKTVESINSRLQLVMRSGKASLGYKTTI 37
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: A0A7S3HF33_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3HF33_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 1.970e-5 Identity = 22/33 (66.67%), Postives = 30/33 (90.91%), Query Frame = 0 Query: 24 VGAQNKKAIESMNARLQLVMKSGKASLGYKSTI 56 VG + KKA+ES+N+++QLVMKSGK +LGYK+TI Sbjct: 8 VGKKTKKAVESINSKVQLVMKSGKTALGYKTTI 40
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: A0A2P2IBP2_9CRUS (60S ribosomal protein, putative (Fragment) n=2 Tax=Hirondellea gigas TaxID=1518452 RepID=A0A2P2IBP2_9CRUS) HSP 1 Score: 47.4 bits (111), Expect = 3.450e-5 Identity = 25/40 (62.50%), Postives = 31/40 (77.50%), Query Frame = 0 Query: 17 SAGTVFVVGAQNKKAIESMNARLQLVMKSGKASLGYKSTI 56 S G +V + KKA ES+N+RL LVMKSGKA+LGYKST+ Sbjct: 11 SCGDTKMVSKKQKKAQESINSRLTLVMKSGKATLGYKSTL 50
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: A0A7S2USR9_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2USR9_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 3.550e-5 Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = 0 Query: 2 PRSTQAAERSAL-PKRSAGTVFVVGAQNKKAIESMNARLQLVMKSGKASLGYKSTI 56 PR TQ A++S + P + + KK +E+MN++LQLVMKSGKASLGYKS+I Sbjct: 27 PRHTQRAQKSIMAPSKKVSS--------KKTVENMNSQLQLVMKSGKASLGYKSSI 74
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Match: A0A0G4J7S9_PLABS (Ribosomal_L7Ae domain-containing protein n=2 Tax=Plasmodiophoridae TaxID=37358 RepID=A0A0G4J7S9_PLABS) HSP 1 Score: 46.2 bits (108), Expect = 7.690e-5 Identity = 23/28 (82.14%), Postives = 27/28 (96.43%), Query Frame = 0 Query: 29 KKAIESMNARLQLVMKSGKASLGYKSTI 56 KKAIES+N+RLQLV+KSGK SLGYKST+ Sbjct: 11 KKAIESINSRLQLVVKSGKYSLGYKSTL 38 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8544.17578.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 9
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8544.17578.1 ID=prot_L-elsbetiae_contig8544.17578.1|Name=mRNA_L-elsbetiae_contig8544.17578.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=56bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|