prot_L-elsbetiae_contig7913.16870.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7913.16870.1 vs. uniprot
Match: D8LDP3_ECTSI (RGS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDP3_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 1.110e-8 Identity = 40/74 (54.05%), Postives = 47/74 (63.51%), Query Frame = 0 Query: 2 GARLGGLGGQAPRGLHGCVAVAAPTSPPXXXXPPRHGDPASPAA----GRAKGRRGSVRSPPAPSGAPRAYGSP 71 GA+ G + GQAPRGLHG A+AA +P + + AA GR +GRRGSVRSPP PSG PRAYGSP Sbjct: 269 GAKGGTILGQAPRGLHGVAAIAATPAPGSPDSATKRAAATATAALPMKGRGQGRRGSVRSPPRPSGPPRAYGSP 342
BLAST of mRNA_L-elsbetiae_contig7913.16870.1 vs. uniprot
Match: A0A6H5JUK7_9PHAE (RGS domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUK7_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 1.790e-7 Identity = 37/66 (56.06%), Postives = 41/66 (62.12%), Query Frame = 0 Query: 10 GQAPRGLHGCVAVAAPTSPPXXXXPPRHGDPASPAA----GRAKGRRGSVRSPPAPSGAPRAYGSP 71 GQAPRGLHG A+AA P + A+ AA GR +GRRG VRSPP PSG PRAYGSP Sbjct: 528 GQAPRGLHGVAAIAATPVPGSPDSATKRAAAAATAALPVEGRGQGRRGFVRSPPRPSGPPRAYGSP 593 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7913.16870.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7913.16870.1 ID=prot_L-elsbetiae_contig7913.16870.1|Name=mRNA_L-elsbetiae_contig7913.16870.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=89bpback to top |