prot_L-elsbetiae_contig7441.16331.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7441.16331.1 vs. uniprot
Match: D7FP32_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FP32_ECTSI) HSP 1 Score: 80.1 bits (196), Expect = 1.570e-16 Identity = 40/79 (50.63%), Postives = 54/79 (68.35%), Query Frame = 0 Query: 2 DVFSRFWPLLLWAAASSSEIEDGLLYRWMQDASECDAELPRGAALWELVAGGKEVKNEAGEV-TRPAKEPTLQAKKGEL 79 ++FS FWPLLLWA +SS EIEDGLLYRW++DAS A + ++LVAG K++ GE T A+ TL+A+KG + Sbjct: 53 ELFSEFWPLLLWAVSSSDEIEDGLLYRWIKDASGYGASFSKSNKFFKLVAGETVAKDKTGEAATEAAESVTLRAQKGGM 131
BLAST of mRNA_L-elsbetiae_contig7441.16331.1 vs. uniprot
Match: A0A6H5JLT9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLT9_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.390e-12 Identity = 30/51 (58.82%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 2 DVFSRFWPLLLWAAASSSEIEDGLLYRWMQDASECDAELPRGAALWELVAG 52 ++ S FWPLL WAA+SS EIEDGLLYRWM+DAS+ A + ++LVAG Sbjct: 27 ELLSEFWPLLRWAASSSDEIEDGLLYRWMKDASDYGASFSKSNKFFKLVAG 77 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7441.16331.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7441.16331.1 ID=prot_L-elsbetiae_contig7441.16331.1|Name=mRNA_L-elsbetiae_contig7441.16331.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=112bpback to top |