prot_L-elsbetiae_contig6713.15455.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6713.15455.1 vs. uniprot
Match: A0A6H5K182_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K182_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 9.610e-14 Identity = 47/65 (72.31%), Postives = 48/65 (73.85%), Query Frame = 0 Query: 7 KNGLLSCLEAVLEACPRSGSGSAAAGAALAALRKSMAACERSAKRPPPDAQAHALARAALATWLS 71 K GLLSCL AVLE GS S AA AL ALR SM+ACER KRPPPDAQ HALARAALA WLS Sbjct: 1933 KKGLLSCLRAVLEVSR--GSESLAAAGALRALRTSMSACERLGKRPPPDAQTHALARAALAAWLS 1995
BLAST of mRNA_L-elsbetiae_contig6713.15455.1 vs. uniprot
Match: D7G8A9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8A9_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 1.770e-13 Identity = 46/66 (69.70%), Postives = 49/66 (74.24%), Query Frame = 0 Query: 7 KNGLLSCLEAVLEACPRSGSGSAAAGAALAALRKSMAACERSAKRPPPDAQAHALARAALATWLSP 72 K G LSCL AVLE GS + AA AL ALR SM+ACE+ KRPPPDAQAHALARAALA WLSP Sbjct: 1494 KKGFLSCLRAVLEISR--GSENLAAAGALRALRTSMSACEQLGKRPPPDAQAHALARAALAAWLSP 1557 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6713.15455.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6713.15455.1 ID=prot_L-elsbetiae_contig6713.15455.1|Name=mRNA_L-elsbetiae_contig6713.15455.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=118bpback to top |