mRNA_L-elsbetiae_contig6713.15455.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6713.15455.1 vs. uniprot
Match: A0A6H5K182_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K182_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 9.610e-14 Identity = 47/65 (72.31%), Postives = 48/65 (73.85%), Query Frame = 1 Query: 19 KNGLLSCLEAVLEACPRSGSGSAAAGAALAALRKSMAACERSAKRPPPDAQAHALARAALATWLS 213 K GLLSCL AVLE GS S AA AL ALR SM+ACER KRPPPDAQ HALARAALA WLS Sbjct: 1933 KKGLLSCLRAVLEVSR--GSESLAAAGALRALRTSMSACERLGKRPPPDAQTHALARAALAAWLS 1995
BLAST of mRNA_L-elsbetiae_contig6713.15455.1 vs. uniprot
Match: D7G8A9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8A9_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 1.770e-13 Identity = 46/66 (69.70%), Postives = 49/66 (74.24%), Query Frame = 1 Query: 19 KNGLLSCLEAVLEACPRSGSGSAAAGAALAALRKSMAACERSAKRPPPDAQAHALARAALATWLSP 216 K G LSCL AVLE GS + AA AL ALR SM+ACE+ KRPPPDAQAHALARAALA WLSP Sbjct: 1494 KKGFLSCLRAVLEISR--GSENLAAAGALRALRTSMSACEQLGKRPPPDAQAHALARAALAAWLSP 1557 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6713.15455.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6713.15455.1 >prot_L-elsbetiae_contig6713.15455.1 ID=prot_L-elsbetiae_contig6713.15455.1|Name=mRNA_L-elsbetiae_contig6713.15455.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=118bp AERRERKNGLLSCLEAVLEACPRSGSGSAAAGAALAALRKSMAACERSAKback to top mRNA from alignment at L-elsbetiae_contig6713:5661..6673- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6713.15455.1 ID=mRNA_L-elsbetiae_contig6713.15455.1|Name=mRNA_L-elsbetiae_contig6713.15455.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1013bp|location=Sequence derived from alignment at L-elsbetiae_contig6713:5661..6673- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6713:5661..6673- >mRNA_L-elsbetiae_contig6713.15455.1 ID=mRNA_L-elsbetiae_contig6713.15455.1|Name=mRNA_L-elsbetiae_contig6713.15455.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=708bp|location=Sequence derived from alignment at L-elsbetiae_contig6713:5661..6673- (Laminarionema elsbetiae ELsaHSoW15)back to top |