prot_L-elsbetiae_contig613.14694.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig613.14694.1 vs. uniprot
Match: D8LT82_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LT82_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 1.020e-6 Identity = 50/118 (42.37%), Postives = 67/118 (56.78%), Query Frame = 0 Query: 30 DDSAKWRRRYEHLAGLLAERTKRSSEKTDRLATPTKT------KTSPRSTRTLI----TYASSGGSTISQQETRPRSVTASSTSSIGVQGDLVPTTKPSAVVDGSSNTTPRPPSPPLA 137 DD+ WRRRYEHLAGLLA +TK++S RLAT +T ++SPR R ++ T S G T S +E P S S+ ++ G P + P + SSNT+PRPPSP +A Sbjct: 815 DDTGTWRRRYEHLAGLLAVQTKQNSAMASRLATSGRTGPSSSRRSSPR--RRIVPPAETPLSLGTPTASPEERLPHSTGPST--AVSKNGGAKPRSSPKRA-NRSSNTSPRPPSPAIA 927 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig613.14694.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig613.14694.1 ID=prot_L-elsbetiae_contig613.14694.1|Name=mRNA_L-elsbetiae_contig613.14694.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=161bpback to top |