prot_L-elsbetiae_contig590.14367.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A6H5L333_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L333_9PHAE) HSP 1 Score: 96.7 bits (239), Expect = 1.350e-23 Identity = 45/50 (90.00%), Postives = 46/50 (92.00%), Query Frame = 0 Query: 1 MLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIKE 50 MLVG DRCLGDIVSEMLSTIED D HEEAHIYLCTLFPQFAHIFSE+KE Sbjct: 1 MLVGTDRCLGDIVSEMLSTIEDNDKSHEEAHIYLCTLFPQFAHIFSEMKE 50
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: D7FNR0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNR0_ECTSI) HSP 1 Score: 95.9 bits (237), Expect = 5.810e-22 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 0 Query: 1 MLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIKE 50 MLVGADRCLGDIVSEML+TIED D+ HE+AHIYLCTLFPQF+HIFSE+KE Sbjct: 283 MLVGADRCLGDIVSEMLATIEDNDESHEDAHIYLCTLFPQFSHIFSEMKE 332
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A485KK40_9STRA (Aste57867_8354 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KK40_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 2.440e-5 Identity = 22/48 (45.83%), Postives = 33/48 (68.75%), Query Frame = 0 Query: 2 LVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIK 49 L+G +RC G++V+EMLS IEDED E + + +FP FA +F ++K Sbjct: 173 LLGLERCAGEVVTEMLSIIEDEDSEEGEMRLVM-EVFPSFADLFGQLK 219
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A1V9ZCL8_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9ZCL8_9STRA) HSP 1 Score: 48.5 bits (114), Expect = 3.440e-5 Identity = 21/48 (43.75%), Postives = 33/48 (68.75%), Query Frame = 0 Query: 2 LVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIK 49 L+G +RC G++V+EML IEDED E + + +FP FA ++S++K Sbjct: 186 LLGLERCAGEVVTEMLQVIEDEDSEEGEMRLVM-EIFPNFADLYSQLK 232
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A6A4ZLR0_9STRA (Uncharacterized protein n=3 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A4ZLR0_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 4.570e-5 Identity = 21/48 (43.75%), Postives = 34/48 (70.83%), Query Frame = 0 Query: 2 LVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIK 49 L+G +RC+G++V+EML IED+D E + + +FP FA +FS++K Sbjct: 167 LLGLERCMGEVVTEMLHIIEDDDGEEGEMRLVM-DVFPSFADLFSQLK 213 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig590.14367.1 ID=prot_L-elsbetiae_contig590.14367.1|Name=mRNA_L-elsbetiae_contig590.14367.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=50bpback to top |