mRNA_L-elsbetiae_contig590.14367.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: D7FNR0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNR0_ECTSI) HSP 1 Score: 102 bits (253), Expect = 4.090e-24 Identity = 46/53 (86.79%), Postives = 51/53 (96.23%), Query Frame = 1 Query: 4 RREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIKE 162 RREMLVGADRCLGDIVSEML+TIED D+ HE+AHIYLCTLFPQF+HIFSE+KE Sbjct: 280 RREMLVGADRCLGDIVSEMLATIEDNDESHEDAHIYLCTLFPQFSHIFSEMKE 332
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A6H5L333_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L333_9PHAE) HSP 1 Score: 97.1 bits (240), Expect = 1.130e-23 Identity = 45/50 (90.00%), Postives = 46/50 (92.00%), Query Frame = 1 Query: 13 MLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIKE 162 MLVG DRCLGDIVSEMLSTIED D HEEAHIYLCTLFPQFAHIFSE+KE Sbjct: 1 MLVGTDRCLGDIVSEMLSTIEDNDKSHEEAHIYLCTLFPQFAHIFSEMKE 50
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: I2CQC4_NANGC (Uncharacterized protein (Fragment) n=1 Tax=Nannochloropsis gaditana (strain CCMP526) TaxID=1093141 RepID=I2CQC4_NANGC) HSP 1 Score: 52.0 bits (123), Expect = 1.330e-7 Identity = 22/54 (40.74%), Postives = 34/54 (62.96%), Query Frame = 1 Query: 1 FRREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIKE 162 FRR+ L+G +RC G++V+EML +E+ DDP E TLFP ++ ++ E Sbjct: 3 FRRDALMGLERCAGELVTEMLLLVEESDDPEEAEMRLALTLFPLLTDLYRQMLE 56
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A485KK40_9STRA (Aste57867_8354 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KK40_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 3.100e-6 Identity = 23/52 (44.23%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 4 RREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIK 159 +R+ L+G +RC G++V+EMLS IEDED E + + +FP FA +F ++K Sbjct: 169 KRDGLLGLERCAGEVVTEMLSIIEDEDSEEGEMRLVM-EVFPSFADLFGQLK 219
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A1V9ZCL8_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9ZCL8_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 4.440e-6 Identity = 22/52 (42.31%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 4 RREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIK 159 +R+ L+G +RC G++V+EML IEDED E + + +FP FA ++S++K Sbjct: 182 KRDGLLGLERCAGEVVTEMLQVIEDEDSEEGEMRLVM-EIFPNFADLYSQLK 232
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A6A4ZLR0_9STRA (Uncharacterized protein n=3 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A4ZLR0_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 5.790e-6 Identity = 22/52 (42.31%), Postives = 37/52 (71.15%), Query Frame = 1 Query: 4 RREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIK 159 +R+ L+G +RC+G++V+EML IED+D E + + +FP FA +FS++K Sbjct: 163 KRDGLLGLERCMGEVVTEMLHIIEDDDGEEGEMRLVM-DVFPSFADLFSQLK 213
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A7S2UYJ0_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UYJ0_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 7.010e-6 Identity = 23/51 (45.10%), Postives = 36/51 (70.59%), Query Frame = 1 Query: 4 RREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEI 156 +R++L G DRCLG+IVS++L +ED EEA + L LFP+F+ +F ++ Sbjct: 83 KRDLLEGTDRCLGEIVSDVLRALEDL--AVEEAQVKLLGLFPEFSSLFQQL 131
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A4D9CSC2_9STRA (Uncharacterized protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9CSC2_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 8.770e-6 Identity = 21/54 (38.89%), Postives = 34/54 (62.96%), Query Frame = 1 Query: 1 FRREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIKE 162 FRR+ L+G +RC G++V+EML +E+ D+P E TLFP ++ ++ E Sbjct: 241 FRRDALMGLERCAGELVTEMLLLVEESDEPEEAEMRLALTLFPLLTDLYRQMLE 294
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A067CQT9_SAPPC (Uncharacterized protein n=2 Tax=Saprolegnia TaxID=4769 RepID=A0A067CQT9_SAPPC) HSP 1 Score: 49.7 bits (117), Expect = 1.540e-5 Identity = 21/52 (40.38%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 4 RREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIK 159 +R+ L+G +RC G++V+EML IED+D E + + +FP FA ++S++K Sbjct: 173 KRDGLLGLERCAGEVVTEMLEVIEDDDGEEGEMRLVM-EIFPNFADLYSQLK 223
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Match: A0A6G0XFD0_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0XFD0_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 1.550e-5 Identity = 22/52 (42.31%), Postives = 35/52 (67.31%), Query Frame = 1 Query: 4 RREMLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIK 159 +R+ L+G +RC G++V+EML IEDED E + + +FP FA +F ++K Sbjct: 177 KRDGLLGLERCAGEVVTEMLHIIEDEDSEEGEMRLVM-EVFPSFADLFGQLK 227 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig590.14367.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 11
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig590.14367.1 >prot_L-elsbetiae_contig590.14367.1 ID=prot_L-elsbetiae_contig590.14367.1|Name=mRNA_L-elsbetiae_contig590.14367.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=50bp MLVGADRCLGDIVSEMLSTIEDEDDPHEEAHIYLCTLFPQFAHIFSEIKEback to top mRNA from alignment at L-elsbetiae_contig590:1123..1284+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig590.14367.1 ID=mRNA_L-elsbetiae_contig590.14367.1|Name=mRNA_L-elsbetiae_contig590.14367.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=162bp|location=Sequence derived from alignment at L-elsbetiae_contig590:1123..1284+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig590:1123..1284+ >mRNA_L-elsbetiae_contig590.14367.1 ID=mRNA_L-elsbetiae_contig590.14367.1|Name=mRNA_L-elsbetiae_contig590.14367.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=300bp|location=Sequence derived from alignment at L-elsbetiae_contig590:1123..1284+ (Laminarionema elsbetiae ELsaHSoW15)back to top |