prot_L-elsbetiae_contig5890.14356.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5890.14356.1 vs. uniprot
Match: A0A1Y2CB00_9FUNG (L domain-like protein n=1 Tax=Rhizoclosmatium globosum TaxID=329046 RepID=A0A1Y2CB00_9FUNG) HSP 1 Score: 72.4 bits (176), Expect = 1.120e-13 Identity = 31/40 (77.50%), Postives = 35/40 (87.50%), Query Frame = 0 Query: 11 PQIVSGWEHSTYAHRSTDRYSYIGKDDTTGEPEWIDYGGK 50 P I+SGWEHSTYAHR T+RY+YIGKDD GEP+WIDYG K Sbjct: 235 PTIISGWEHSTYAHRDTERYAYIGKDD--GEPQWIDYGSK 272
BLAST of mRNA_L-elsbetiae_contig5890.14356.1 vs. uniprot
Match: A0A0L0G851_9EUKA (Uncharacterized protein n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0G851_9EUKA) HSP 1 Score: 65.1 bits (157), Expect = 1.170e-12 Identity = 30/51 (58.82%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 4 PPATQDNPQIVSGWEHSTYAHRSTDRYSYIGKDDTTGEPEWIDYGGKQANA 54 PP+ + PQI+SGWEHS YAHR T+R +Y GK+D G+PEW+DYG K A + Sbjct: 9 PPSPE--PQIISGWEHSRYAHRDTERNAYKGKNDG-GDPEWLDYGSKSARS 56 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5890.14356.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5890.14356.1 ID=prot_L-elsbetiae_contig5890.14356.1|Name=mRNA_L-elsbetiae_contig5890.14356.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=64bpback to top |