Homology
BLAST of mRNA_L-elsbetiae_contig5665.14018.1 vs. uniprot
Match:
D8LGE1_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LGE1_ECTSI)
HSP 1 Score: 71.6 bits (174), Expect = 2.100e-12
Identity = 30/32 (93.75%), Postives = 32/32 (100.00%), Query Frame = 0
Query: 79 RLLKEGGVWINFGPLLFHWSDSSLRETDERFQ 110
RLLKEGGVWINFGPLL+HWSDSSLR+TDERFQ
Sbjct: 260 RLLKEGGVWINFGPLLYHWSDSSLRKTDERFQ 291
The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5665.14018.1 vs. uniprot
Analysis Date: 2022-09-16 (
Diamond blastp: OGS1.0 vs UniRef90 )
Total hits: 1
Q E R S E T K R F L R S C V E R S M P F D T Y T Y A K T K K N I G I F Y L S C T C G E N R V L T A S V R C L L Q R A N S C T Q E N L V P P A I A P A F Y C L R L L K E G G V W I N F G P L L F H W S D S S L R E T D E R F Q 10 20 30 40 50 60 70 80 90 100 110 Expect = 2.10e-12 / Id = 93.75 Sequence D8LGE1_ECTSI
Match Name E-value Identity Description
D8LGE1_ECTSI 2.100e-12 93.75 Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2... [more]
back to top
InterPro
Analysis Name:
InterProScan on OGS1.0
Date Performed: 2022-09-29
Q E R S E T K R F L R S C V E R S M P F D T Y T Y A K T K K N I G I F Y L S C T C G E N R V L T A S V R C L L Q R A N S C T Q E N L V P P A I A P A F Y C L R L L K E G G V W I N F G P L L F H W S D S S L R E T D E R F Q 10 20 30 40 50 60 70 80 90 100 110 Expect = 6.9E-6 / Score = 25.4 Sequence PF07942
IPR Term IPR Description Source Source Term Source Description Alignment
IPR012901 N2227-like PFAM PF07942 N2227 coord: 79..103 e-value: 6.9E-6 score: 25.4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence
>prot_L-elsbetiae_contig5665.14018.1 ID=prot_L-elsbetiae_contig5665.14018.1|Name=mRNA_L-elsbetiae_contig5665.14018.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=110bp QERSETKRFLRSCVERSMPFDTYTYAKTKKNIGIFYLSCTCGENRVLTAS VRCLLQRANSCTQENLVPPAIAPAFYCLRLLKEGGVWINFGPLLFHWSDS SLRETDERFQ back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term Definition
IPR012901 N2227