prot_L-elsbetiae_contig5219.13324.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5219.13324.1 vs. uniprot
Match: A0A6H5JWZ4_9PHAE (CBFD_NFYB_HMF domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWZ4_9PHAE) HSP 1 Score: 87.4 bits (215), Expect = 4.190e-20 Identity = 40/48 (83.33%), Postives = 46/48 (95.83%), Query Frame = 0 Query: 1 SELFLERFATQAFGHAEKLGRKTIKYRDVSDIRVKDPNLLFLEAVVPP 48 SE+FLE+FA +AF HAEKLGRKTIKYRDVSD+R++DPNLLFLEAVVPP Sbjct: 166 SEIFLEKFAARAFDHAEKLGRKTIKYRDVSDVRLEDPNLLFLEAVVPP 213
BLAST of mRNA_L-elsbetiae_contig5219.13324.1 vs. uniprot
Match: D8LBX1_ECTSI (Histone-like transcription factor family (CBF/NF-Y) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBX1_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 1.270e-19 Identity = 40/48 (83.33%), Postives = 45/48 (93.75%), Query Frame = 0 Query: 1 SELFLERFATQAFGHAEKLGRKTIKYRDVSDIRVKDPNLLFLEAVVPP 48 SE+FLE+ A +AF HAEKLGRKTIKYRDVSD+RV+DPNLLFLEAVVPP Sbjct: 170 SEIFLEKLAARAFDHAEKLGRKTIKYRDVSDVRVEDPNLLFLEAVVPP 217
BLAST of mRNA_L-elsbetiae_contig5219.13324.1 vs. uniprot
Match: A0A6V1PCP5_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1PCP5_HETAK) HSP 1 Score: 59.7 bits (143), Expect = 7.790e-10 Identity = 27/45 (60.00%), Postives = 33/45 (73.33%), Query Frame = 0 Query: 3 LFLERFATQAFGHAEKLGRKTIKYRDVSDIRVKDPNLLFLEAVVP 47 LFLE+FA +F A+ G K I+Y DV+D RV DPNLLFLE V+P Sbjct: 107 LFLEKFAQDSFAKAQTRGAKMIRYEDVADARVSDPNLLFLEGVIP 151 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5219.13324.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5219.13324.1 ID=prot_L-elsbetiae_contig5219.13324.1|Name=mRNA_L-elsbetiae_contig5219.13324.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=49bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|