prot_L-elsbetiae_contig2107.6386.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: A0A6H5L5J2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5J2_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 2.820e-11 Identity = 24/30 (80.00%), Postives = 28/30 (93.33%), Query Frame = 0 Query: 22 GGDPHFCLPGPPDEMALLLLKLVWAVHQER 51 G DPHFCLPGPPDE+ LLLLK++WA+HQER Sbjct: 185 GNDPHFCLPGPPDELGLLLLKIIWAIHQER 214
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: D7G974_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G974_ECTSI) HSP 1 Score: 58.9 bits (141), Expect = 2.980e-9 Identity = 22/34 (64.71%), Postives = 29/34 (85.29%), Query Frame = 0 Query: 18 EKYVGGDPHFCLPGPPDEMALLLLKLVWAVHQER 51 E+ V DPHFC+PGPPDE+ +LLLKL+WA+H E+ Sbjct: 152 ERTVEDDPHFCMPGPPDEVGILLLKLLWALHHEK 185
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: A0A6H5KAG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAG2_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 6.320e-9 Identity = 22/34 (64.71%), Postives = 29/34 (85.29%), Query Frame = 0 Query: 18 EKYVGGDPHFCLPGPPDEMALLLLKLVWAVHQER 51 E+ V DPHFC+PGPPDE+ +LLLKL+WA+H E+ Sbjct: 418 ERTVENDPHFCMPGPPDEVGILLLKLLWALHHEK 451
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: A0A6H5LBA5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LBA5_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 1.150e-8 Identity = 21/28 (75.00%), Postives = 26/28 (92.86%), Query Frame = 0 Query: 24 DPHFCLPGPPDEMALLLLKLVWAVHQER 51 DPHFCLPGPPDE+ LLLK++WA++QER Sbjct: 187 DPHFCLPGPPDELGFLLLKIIWALYQER 214
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: D7G2P7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2P7_ECTSI) HSP 1 Score: 49.7 bits (117), Expect = 1.590e-5 Identity = 17/28 (60.71%), Postives = 25/28 (89.29%), Query Frame = 0 Query: 24 DPHFCLPGPPDEMALLLLKLVWAVHQER 51 +PHFC+PGPP+E+ +LLL++ WAV+ ER Sbjct: 390 NPHFCMPGPPNEIGILLLEMAWAVYAER 417
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Match: A0A6H5KUF6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUF6_9PHAE) HSP 1 Score: 49.7 bits (117), Expect = 1.590e-5 Identity = 17/28 (60.71%), Postives = 25/28 (89.29%), Query Frame = 0 Query: 24 DPHFCLPGPPDEMALLLLKLVWAVHQER 51 +PHFC+PGPP+E+ +LLL++ WAV+ ER Sbjct: 386 NPHFCMPGPPNEIGILLLEMAWAVYAER 413 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2107.6386.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig2107.6386.1 ID=prot_L-elsbetiae_contig2107.6386.1|Name=mRNA_L-elsbetiae_contig2107.6386.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=53bpback to top |