prot_L-elsbetiae_contig19487.5789.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: A0A6H5JII8_9PHAE (MFS domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JII8_9PHAE) HSP 1 Score: 97.8 bits (242), Expect = 1.660e-22 Identity = 43/52 (82.69%), Postives = 50/52 (96.15%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVG 52 DP L+FNETKYGTVMSAIS+PNLFMPFFGG+FLDSKGHK GI++FL+LEL+G Sbjct: 160 DPKLHFNETKYGTVMSAISIPNLFMPFFGGLFLDSKGHKQGIIIFLSLELIG 211
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: D7FMB1_ECTSI (MFS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMB1_ECTSI) HSP 1 Score: 94.0 bits (232), Expect = 2.530e-21 Identity = 41/52 (78.85%), Postives = 49/52 (94.23%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVG 52 DP L+FNETKYGTVMSAI +PNLFMPFFGG+FLDSKGHK GI++FL++EL+G Sbjct: 30 DPKLHFNETKYGTVMSAIWIPNLFMPFFGGLFLDSKGHKQGIIMFLSVELIG 81
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: A0A836CI63_9STRA (Major facilitator superfamily domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CI63_9STRA) HSP 1 Score: 67.4 bits (163), Expect = 8.880e-12 Identity = 30/52 (57.69%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVG 52 +P LNF KYG++MSA S+PN+ MPF GGV LDSKG + GI FL + L G Sbjct: 171 NPKLNFTGVKYGSIMSAQSLPNIVMPFLGGVILDSKGPRVGIKTFLAIALAG 222
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: A0A835Z1U8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z1U8_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 1.580e-11 Identity = 27/51 (52.94%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 2 PDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVG 52 P L+FN KYG++MSA S+PN+ MPFFGG+ LDSK + G+ FL + + G Sbjct: 135 PSLHFNAIKYGSIMSAQSLPNVLMPFFGGIILDSKNSRVGLRTFLAVTVAG 185
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: K8YXS2_NANGC (Major facilitator superfamily n=1 Tax=Nannochloropsis gaditana (strain CCMP526) TaxID=1093141 RepID=K8YXS2_NANGC) HSP 1 Score: 63.5 bits (153), Expect = 2.040e-10 Identity = 27/53 (50.94%), Postives = 39/53 (73.58%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVGK 53 D L+ +ET+YG ++S S+PN F+PF GGVFLD +GH+ +LFL L L+G+ Sbjct: 199 DARLHLSETRYGLLLSMSSLPNFFIPFLGGVFLDKRGHRFATLLFLFLVLLGQ 251
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: W7TQA4_9STRA (Major facilitator superfamily n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7TQA4_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 2.040e-10 Identity = 27/53 (50.94%), Postives = 39/53 (73.58%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVGK 53 D L+ +ET+YG ++S S+PN F+PF GGVFLD +GH+ +LFL L L+G+ Sbjct: 347 DARLHLSETRYGLLLSMSSLPNFFIPFLGGVFLDKRGHRFATLLFLFLVLLGQ 399
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: A0A8K1CGU8_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CGU8_PYTOL) HSP 1 Score: 57.4 bits (137), Expect = 3.030e-8 Identity = 25/53 (47.17%), Postives = 35/53 (66.04%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVGK 53 DPD T YG ++SA+SVPN+F+P +GG FLD GH++ I FL +G+ Sbjct: 78 DPDFPMTNTMYGALVSAVSVPNMFIPLYGGRFLDKSGHRS-IQFFLIWICIGQ 129
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: A0A5D6XU00_9STRA (MFS domain-containing protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6XU00_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 3.030e-8 Identity = 26/53 (49.06%), Postives = 35/53 (66.04%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVGK 53 DPD T YG ++SA+SVPN+F+P FGG LD GH + I++FL VG+ Sbjct: 120 DPDFPITNTMYGALISAVSVPNMFLPLFGGRLLDKSGHAS-ILVFLVWICVGQ 171
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: A0A6G0WCA3_9STRA (MFS domain-containing protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0WCA3_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 4.140e-8 Identity = 25/53 (47.17%), Postives = 38/53 (71.70%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVGK 53 DP + + T YG + SA+S+PN+ +PFFGG LDSKGH + I++FL + +G+ Sbjct: 61 DPVVPVSNTMYGALNSAVSIPNMIVPFFGGHVLDSKGHDS-ILIFLVVMCIGQ 112
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Match: A0A396ZS22_9STRA (MFS domain-containing protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A396ZS22_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 9.780e-8 Identity = 26/52 (50.00%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 1 DPDLNFNETKYGTVMSAISVPNLFMPFFGGVFLDSKGHKTGIMLFLTLELVG 52 D T YG + SA+SVPN+ +PFFGG +DS+GH T IM FL L +G Sbjct: 14 DKAFPITNTMYGALNSAVSVPNMIIPFFGGHMIDSRGHYT-IMFFLVLMFIG 64 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19487.5789.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19487.5789.1 ID=prot_L-elsbetiae_contig19487.5789.1|Name=mRNA_L-elsbetiae_contig19487.5789.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=53bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|