prot_L-elsbetiae_contig1906.5611.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1906.5611.1 vs. uniprot
Match: A0A6H5JK20_9PHAE (Hist_deacetyl domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK20_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 1.770e-10 Identity = 43/75 (57.33%), Postives = 49/75 (65.33%), Query Frame = 0 Query: 6 RGPGRPRLSDRRGVPLG-------------GXXXXXNAYGEEMRPSGSSTVEIRLGFTGRRFVRLKLDNCPRPEA 67 RGPGRPRL++RRGV G XXXX + YG E RP+ S TVE+RL FTG+R VRLKLDNCP EA Sbjct: 166 RGPGRPRLAERRGVSAGRGGSGSVGIVGXXXXXXXADPYGVERRPAWSGTVEVRLAFTGQRSVRLKLDNCPSSEA 240
BLAST of mRNA_L-elsbetiae_contig1906.5611.1 vs. uniprot
Match: D8LN85_ECTSI (Histone deacetylase superfamily n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LN85_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 2.580e-5 Identity = 29/31 (93.55%), Postives = 29/31 (93.55%), Query Frame = 0 Query: 166 FFTPKPMAGPRPALARGGWASLTASTAAATF 196 FFTP PMAGPRPALARGGWASL ASTAAATF Sbjct: 501 FFTPTPMAGPRPALARGGWASLFASTAAATF 531 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1906.5611.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1906.5611.1 ID=prot_L-elsbetiae_contig1906.5611.1|Name=mRNA_L-elsbetiae_contig1906.5611.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=309bpback to top |