prot_L-elsbetiae_contig17673.4994.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17673.4994.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
CPAQSSKRNRREPWPSPENFAGKPLTEATDVYSLGMIFYALLRGDKPFGDNKEQFDLALEGRYRPPMDPSWHKDYAQVVEDMWLQDPKKRPSARQVVARLQDIKEKLPRF*102030405060708090100110Expect = 2.89e-35 / Id = 55.56Expect = 6.11e-35 / Id = 55.14Expect = 1.24e-34 / Id = 54.21Expect = 1.72e-34 / Id = 52.34Expect = 1.21e-32 / Id = 56.07Expect = 9.03e-30 / Id = 49.53Expect = 2.51e-29 / Id = 55.10Expect = 3.53e-29 / Id = 52.58Expect = 1.47e-26 / Id = 42.74Expect = 5.98e-21 / Id = 45.37SequenceD7FYC9_ECTSIA0A6H5K7R0_9PHAED7G7W7_ECTSID8LN76_ECTSID8LMS6_ECTSID7FNX1_ECTSIA0A6H5LAH0_9PHAED8LN73_ECTSIA0A6H5JU33_9PHAEA0A6H5JFK2_9PHAE
Match NameE-valueIdentityDescription
D7FYC9_ECTSI2.890e-3555.56Similar to TAK1 (TGF-beta-activated kinase) n=1 Ta... [more]
A0A6H5K7R0_9PHAE6.110e-3555.14Protein kinase domain-containing protein n=1 Tax=E... [more]
D7G7W7_ECTSI1.240e-3454.21Similar to TAK1 (TGF-beta-activated kinase) n=1 Ta... [more]
D8LN76_ECTSI1.720e-3452.34Serine/threonine protein kinase n=1 Tax=Ectocarpus... [more]
D8LMS6_ECTSI1.210e-3256.07Protein kinase domain-containing protein n=1 Tax=E... [more]
D7FNX1_ECTSI9.030e-3049.53Serine/threonine protein kinase n=1 Tax=Ectocarpus... [more]
A0A6H5LAH0_9PHAE2.510e-2955.10Protein kinase domain-containing protein n=1 Tax=E... [more]
D8LN73_ECTSI3.530e-2952.58Serine/threonine/tyrosine kinase n=1 Tax=Ectocarpu... [more]
A0A6H5JU33_9PHAE1.470e-2642.74Protein kinase domain-containing protein n=1 Tax=E... [more]
A0A6H5JFK2_9PHAE5.980e-2145.37Protein kinase domain-containing protein n=1 Tax=E... [more]

Pages

back to top