prot_L-elsbetiae_contig16225.4259.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16225.4259.1 vs. uniprot
Match: A0A2U7UDZ7_9VIRU (Ankyrin repeat domain containing protein n=1 Tax=Pandoravirus macleodensis TaxID=2107707 RepID=A0A2U7UDZ7_9VIRU) HSP 1 Score: 57.4 bits (137), Expect = 1.990e-8 Identity = 23/40 (57.50%), Postives = 27/40 (67.50%), Query Frame = 0 Query: 1 VQVLKWARANGAPWNSEACTDAVRGGHLHILQWLRMSGCS 40 + VLKWA ANG PW+ +AC DA GGHL +L WL G S Sbjct: 101 MTVLKWAEANGCPWDYDACIDAASGGHLGVLLWLVKGGDS 140
BLAST of mRNA_L-elsbetiae_contig16225.4259.1 vs. uniprot
Match: A0A836CII6_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CII6_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 2.040e-8 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 3 VLKWARANGAPWNSEACTDAVRGGHLHILQWLRMSGCSWDR 43 VL+ A+ NG P +++AC AVRGG LH+LQ+LR GC WD+ Sbjct: 118 VLRDAQTNGVPRDAQACRAAVRGGQLHVLQFLRHIGCRWDK 158
BLAST of mRNA_L-elsbetiae_contig16225.4259.1 vs. uniprot
Match: S4W2I8_9VIRU (Ankyrin repeat domain containing protein n=1 Tax=Pandoravirus salinus TaxID=1349410 RepID=S4W2I8_9VIRU) HSP 1 Score: 53.1 bits (126), Expect = 6.300e-7 Identity = 19/29 (65.52%), Postives = 24/29 (82.76%), Query Frame = 0 Query: 3 VLKWARANGAPWNSEACTDAVRGGHLHIL 31 V++WARANG PW++EAC A RGGHL +L Sbjct: 62 VMRWARANGCPWDAEACAGAARGGHLRLL 90
BLAST of mRNA_L-elsbetiae_contig16225.4259.1 vs. uniprot
Match: A0A2V0P128_9CHLO (Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0P128_9CHLO) HSP 1 Score: 49.7 bits (117), Expect = 1.070e-5 Identity = 18/35 (51.43%), Postives = 26/35 (74.29%), Query Frame = 0 Query: 1 VQVLKWARANGAPWNSEACTDAVRGGHLHILQWLR 35 ++ L+ ARA G W++ C++A RGGHL +LQWLR Sbjct: 130 LEALQCARALGCEWSAHTCSEAARGGHLAVLQWLR 164 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16225.4259.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig16225.4259.1 ID=prot_L-elsbetiae_contig16225.4259.1|Name=mRNA_L-elsbetiae_contig16225.4259.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=44bpback to top |