prot_L-elsbetiae_contig15378.3803.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15378.3803.1 vs. uniprot
Match: D7FUJ6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUJ6_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 4.060e-8 Identity = 28/40 (70.00%), Postives = 29/40 (72.50%), Query Frame = 0 Query: 1 MVDVVSKRCTHDGCTKQPSYGKTGGK-AEYCRDHAKDGMV 39 MVDVVSKRC H GCTK+PSYG G K AE C HA GMV Sbjct: 1 MVDVVSKRCGHPGCTKRPSYGNDGSKKAELCAQHALQGMV 40
BLAST of mRNA_L-elsbetiae_contig15378.3803.1 vs. uniprot
Match: D8LD34_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LD34_ECTSI) HSP 1 Score: 53.1 bits (126), Expect = 6.090e-5 Identity = 24/39 (61.54%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 1 MVDVVSKRCTHDGCTKQPSYGKTGGK-AEYCRDHAKDGM 38 MV+VV+K C H GCTK+PSYGK+G K AE+C HA+ M Sbjct: 1 MVNVVTKPCGHPGCTKKPSYGKSGTKKAEFCSQHAEPDM 39 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15378.3803.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15378.3803.1 ID=prot_L-elsbetiae_contig15378.3803.1|Name=mRNA_L-elsbetiae_contig15378.3803.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=193bpback to top |