prot_L-elsbetiae_contig15.3591.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15.3591.1 vs. uniprot
Match: D7G9E1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G9E1_ECTSI) HSP 1 Score: 79.7 bits (195), Expect = 3.310e-16 Identity = 38/45 (84.44%), Postives = 41/45 (91.11%), Query Frame = 0 Query: 1 AAERLLSVTRALLLVNADHGSAWNARKEVVLDGLCEGGSIPQEIK 45 AA LLSVTRALLLVNADHGSAWN RK++V+DGLCEG SIPQEIK Sbjct: 140 AAATLLSVTRALLLVNADHGSAWNTRKQLVVDGLCEGSSIPQEIK 184
BLAST of mRNA_L-elsbetiae_contig15.3591.1 vs. uniprot
Match: A0A6H5JXA5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXA5_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 4.010e-15 Identity = 36/45 (80.00%), Postives = 40/45 (88.89%), Query Frame = 0 Query: 1 AAERLLSVTRALLLVNADHGSAWNARKEVVLDGLCEGGSIPQEIK 45 AA LLSVTRALLLVNADH SAWN RK++V+DGLCEG SIPQE+K Sbjct: 128 AAGTLLSVTRALLLVNADHASAWNTRKQLVVDGLCEGSSIPQEVK 172 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15.3591.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15.3591.1 ID=prot_L-elsbetiae_contig15.3591.1|Name=mRNA_L-elsbetiae_contig15.3591.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=48bpback to top |