mRNA_L-elsbetiae_contig15.3591.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15.3591.1 vs. uniprot
Match: D7G9E1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G9E1_ECTSI) HSP 1 Score: 79.7 bits (195), Expect = 3.310e-16 Identity = 38/45 (84.44%), Postives = 41/45 (91.11%), Query Frame = 1 Query: 1 AAERLLSVTRALLLVNADHGSAWNARKEVVLDGLCEGGSIPQEIK 135 AA LLSVTRALLLVNADHGSAWN RK++V+DGLCEG SIPQEIK Sbjct: 140 AAATLLSVTRALLLVNADHGSAWNTRKQLVVDGLCEGSSIPQEIK 184
BLAST of mRNA_L-elsbetiae_contig15.3591.1 vs. uniprot
Match: A0A6H5JXA5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXA5_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 4.010e-15 Identity = 36/45 (80.00%), Postives = 40/45 (88.89%), Query Frame = 1 Query: 1 AAERLLSVTRALLLVNADHGSAWNARKEVVLDGLCEGGSIPQEIK 135 AA LLSVTRALLLVNADH SAWN RK++V+DGLCEG SIPQE+K Sbjct: 128 AAGTLLSVTRALLLVNADHASAWNTRKQLVVDGLCEGSSIPQEVK 172 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15.3591.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig15.3591.1 >prot_L-elsbetiae_contig15.3591.1 ID=prot_L-elsbetiae_contig15.3591.1|Name=mRNA_L-elsbetiae_contig15.3591.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=48bp AAERLLSVTRALLLVNADHGSAWNARKEVVLDGLCEGGSIPQEIKASLback to top mRNA from alignment at L-elsbetiae_contig15:69872..70017- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig15.3591.1 ID=mRNA_L-elsbetiae_contig15.3591.1|Name=mRNA_L-elsbetiae_contig15.3591.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=146bp|location=Sequence derived from alignment at L-elsbetiae_contig15:69872..70017- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig15:69872..70017- >mRNA_L-elsbetiae_contig15.3591.1 ID=mRNA_L-elsbetiae_contig15.3591.1|Name=mRNA_L-elsbetiae_contig15.3591.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=288bp|location=Sequence derived from alignment at L-elsbetiae_contig15:69872..70017- (Laminarionema elsbetiae ELsaHSoW15)back to top |