prot_L-elsbetiae_contig14126.3076.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14126.3076.1 vs. uniprot
Match: A0A6H5KL36_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KL36_9PHAE) HSP 1 Score: 69.7 bits (169), Expect = 1.210e-11 Identity = 36/53 (67.92%), Postives = 38/53 (71.70%), Query Frame = 0 Query: 54 AGRAAASEEEKRAVGGGNREGCLLDVYREPEGNDWGELEDWQGLPGLQLAGGG 106 AGRA A+E+ G G G LLD YREPEGNDWGELEDW GLPGLQLA G Sbjct: 161 AGRAEAAEQ---GAGDGRIGGSLLDTYREPEGNDWGELEDWHGLPGLQLANAG 210
BLAST of mRNA_L-elsbetiae_contig14126.3076.1 vs. uniprot
Match: D7FZY2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZY2_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 1.210e-11 Identity = 36/53 (67.92%), Postives = 38/53 (71.70%), Query Frame = 0 Query: 54 AGRAAASEEEKRAVGGGNREGCLLDVYREPEGNDWGELEDWQGLPGLQLAGGG 106 AGRA A+E+ G G G LLD YREPEGNDWGELEDW GLPGLQLA G Sbjct: 292 AGRAEAAEQ---GAGDGRIGGSLLDAYREPEGNDWGELEDWHGLPGLQLANAG 341 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14126.3076.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig14126.3076.1 ID=prot_L-elsbetiae_contig14126.3076.1|Name=mRNA_L-elsbetiae_contig14126.3076.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=106bpback to top |