mRNA_L-elsbetiae_contig14126.3076.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig14126.3076.1 vs. uniprot
Match: A0A6H5KL36_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KL36_9PHAE) HSP 1 Score: 69.7 bits (169), Expect = 1.210e-11 Identity = 36/53 (67.92%), Postives = 38/53 (71.70%), Query Frame = 1 Query: 160 AGRAAASEEEKRAVGGGNREGCLLDVYREPEGNDWGELEDWQGLPGLQLAGGG 318 AGRA A+E+ G G G LLD YREPEGNDWGELEDW GLPGLQLA G Sbjct: 161 AGRAEAAEQ---GAGDGRIGGSLLDTYREPEGNDWGELEDWHGLPGLQLANAG 210
BLAST of mRNA_L-elsbetiae_contig14126.3076.1 vs. uniprot
Match: D7FZY2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZY2_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 1.210e-11 Identity = 36/53 (67.92%), Postives = 38/53 (71.70%), Query Frame = 1 Query: 160 AGRAAASEEEKRAVGGGNREGCLLDVYREPEGNDWGELEDWQGLPGLQLAGGG 318 AGRA A+E+ G G G LLD YREPEGNDWGELEDW GLPGLQLA G Sbjct: 292 AGRAEAAEQ---GAGDGRIGGSLLDAYREPEGNDWGELEDWHGLPGLQLANAG 341 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig14126.3076.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig14126.3076.1 >prot_L-elsbetiae_contig14126.3076.1 ID=prot_L-elsbetiae_contig14126.3076.1|Name=mRNA_L-elsbetiae_contig14126.3076.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=106bp GLEVGSEAGLTVVTADETPAGTAGTAGTAGTAGTGASASALAREGRDCSGback to top mRNA from alignment at L-elsbetiae_contig14126:3872..4190+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig14126.3076.1 ID=mRNA_L-elsbetiae_contig14126.3076.1|Name=mRNA_L-elsbetiae_contig14126.3076.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=319bp|location=Sequence derived from alignment at L-elsbetiae_contig14126:3872..4190+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig14126:3872..4190+ >mRNA_L-elsbetiae_contig14126.3076.1 ID=mRNA_L-elsbetiae_contig14126.3076.1|Name=mRNA_L-elsbetiae_contig14126.3076.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=636bp|location=Sequence derived from alignment at L-elsbetiae_contig14126:3872..4190+ (Laminarionema elsbetiae ELsaHSoW15)back to top |