prot_L-elsbetiae_contig1381.2882.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1381.2882.1 vs. uniprot
Match: D7FKC8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKC8_ECTSI) HSP 1 Score: 54.3 bits (129), Expect = 2.550e-6 Identity = 29/39 (74.36%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 35 KGVARTSSLLSLFEAQSVEHVTSGGGGGRDNSGPYLDDD 73 + +ARTSSLLSL+EAQSVEHV G RDNSGPYLDDD Sbjct: 1088 RALARTSSLLSLYEAQSVEHVA---GIRRDNSGPYLDDD 1123
BLAST of mRNA_L-elsbetiae_contig1381.2882.1 vs. uniprot
Match: A0A6H5L375_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L375_9PHAE) HSP 1 Score: 50.4 bits (119), Expect = 5.760e-5 Identity = 28/39 (71.79%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 35 KGVARTSSLLSLFEAQSVEHVTSGGGGGRDNSGPYLDDD 73 + VAR SSLLSL+EAQSVE V G RDNSGPYLDDD Sbjct: 1090 RAVARASSLLSLYEAQSVEQVA---GIRRDNSGPYLDDD 1125 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1381.2882.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1381.2882.1 ID=prot_L-elsbetiae_contig1381.2882.1|Name=mRNA_L-elsbetiae_contig1381.2882.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=101bpback to top |