prot_L-elsbetiae_contig12911.2315.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12911.2315.1 vs. uniprot
Match: D7G411_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G411_ECTSI) HSP 1 Score: 102 bits (253), Expect = 6.400e-24 Identity = 48/53 (90.57%), Postives = 50/53 (94.34%), Query Frame = 0 Query: 1 RTEAVFQTPDPVFERTWVFVAPSYDACVAIDLVDASTDRLAGRFETTVMALLQ 53 RTEAVFQTPDPVFERTWVFVAPSYD+CV IDLVDASTDR AGRFETTV+ LLQ Sbjct: 1186 RTEAVFQTPDPVFERTWVFVAPSYDSCVTIDLVDASTDRPAGRFETTVIGLLQ 1238
BLAST of mRNA_L-elsbetiae_contig12911.2315.1 vs. uniprot
Match: A0A6H5L011_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L011_9PHAE) HSP 1 Score: 96.3 bits (238), Expect = 6.830e-22 Identity = 46/53 (86.79%), Postives = 48/53 (90.57%), Query Frame = 0 Query: 1 RTEAVFQTPDPVFERTWVFVAPSYDACVAIDLVDASTDRLAGRFETTVMALLQ 53 RTEAVFQTPDPVFERTWVF APSYD+ V IDLVDASTDR AGRFETTV+ LLQ Sbjct: 1201 RTEAVFQTPDPVFERTWVFAAPSYDSFVTIDLVDASTDRPAGRFETTVIGLLQ 1253 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12911.2315.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12911.2315.1 ID=prot_L-elsbetiae_contig12911.2315.1|Name=mRNA_L-elsbetiae_contig12911.2315.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=55bpback to top |