prot_L-elsbetiae_contig12627.2119.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: A0A1J8Q002_9GAMM (Uncharacterized protein n=2 Tax=Halomonas TaxID=2745 RepID=A0A1J8Q002_9GAMM) HSP 1 Score: 86.3 bits (212), Expect = 6.880e-21 Identity = 44/56 (78.57%), Postives = 46/56 (82.14%), Query Frame = 0 Query: 1 SKLDPLPLDLHVLGLPPAFNLSHDQTLQFKII------PKAAKANQTWLKVQTNSF 50 SKLD LPLDLHVLGLPPAFNLSHDQTLQFKI PK +A+QTWLKVQTNSF Sbjct: 13 SKLDLLPLDLHVLGLPPAFNLSHDQTLQFKIYVILTCHPKVTEADQTWLKVQTNSF 68
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: UPI001EE36D24 (hypothetical protein n=1 Tax=Halomonas sp. A3H3 TaxID=1346287 RepID=UPI001EE36D24) HSP 1 Score: 85.5 bits (210), Expect = 1.280e-20 Identity = 44/56 (78.57%), Postives = 46/56 (82.14%), Query Frame = 0 Query: 1 SKLDPLPLDLHVLGLPPAFNLSHDQTLQFKII------PKAAKANQTWLKVQTNSF 50 SKL LPLDLHVLGLPPAFNLSHDQTLQFKI P+A KA+QTWLKVQTNSF Sbjct: 6 SKLPLLPLDLHVLGLPPAFNLSHDQTLQFKIYVILTCHPRATKADQTWLKVQTNSF 61
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: A0A7U9BXN5_9GAMM (Uncharacterized protein n=2 Tax=Halomonas boliviensis TaxID=223527 RepID=A0A7U9BXN5_9GAMM) HSP 1 Score: 87.0 bits (214), Expect = 1.510e-20 Identity = 45/59 (76.27%), Postives = 47/59 (79.66%), Query Frame = 0 Query: 6 LPLDLHVLGLPPAFNLSHDQTLQFKIIP------KAAKANQTWLKVQTNSFNYRLKTFV 58 LPLDLHVLGLPPAFNLSHDQTLQFKI K +ANQTWLKVQTNSFN LKT+V Sbjct: 70 LPLDLHVLGLPPAFNLSHDQTLQFKIYAVLTRHSKVTEANQTWLKVQTNSFNCCLKTYV 128
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: A0A124F645_9GAMM (Uncharacterized protein (Fragment) n=1 Tax=Halomonas sp. 54_146 TaxID=1635257 RepID=A0A124F645_9GAMM) HSP 1 Score: 85.1 bits (209), Expect = 5.970e-20 Identity = 44/56 (78.57%), Postives = 45/56 (80.36%), Query Frame = 0 Query: 1 SKLDPLPLDLHVLGLPPAFNLSHDQTLQFKIIP------KAAKANQTWLKVQTNSF 50 SKLD LPLDLHVLGLPPAFNLSHDQTLQFKI K +ANQTWLKVQTNSF Sbjct: 1 SKLDLLPLDLHVLGLPPAFNLSHDQTLQFKIYAVLTCHSKVTEANQTWLKVQTNSF 56
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: A0A117KHG4_9GAMM (Uncharacterized protein (Fragment) n=1 Tax=Halomonas sp. 54_146 TaxID=1635257 RepID=A0A117KHG4_9GAMM) HSP 1 Score: 64.7 bits (156), Expect = 2.290e-12 Identity = 31/32 (96.88%), Postives = 31/32 (96.88%), Query Frame = 0 Query: 1 SKLDPLPLDLHVLGLPPAFNLSHDQTLQFKII 32 SKLD LPLDLHVLGLPPAFNLSHDQTLQFKII Sbjct: 4 SKLDLLPLDLHVLGLPPAFNLSHDQTLQFKII 35
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: A0A220RCJ5_9GAMM (Uncharacterized protein n=1 Tax=Halomonas sp. N3-2A TaxID=2014541 RepID=A0A220RCJ5_9GAMM) HSP 1 Score: 62.0 bits (149), Expect = 2.410e-11 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 1 SKLDPLPLDLHVLGLPPAFNLSHDQTLQFKII 32 SKL LPLDLHVLGLPPAFNLSHDQTLQFKII Sbjct: 28 SKLPLLPLDLHVLGLPPAFNLSHDQTLQFKII 59
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: UPI001A929645 (hypothetical protein n=7 Tax=Klebsiella pneumoniae TaxID=573 RepID=UPI001A929645) HSP 1 Score: 59.7 bits (143), Expect = 1.930e-10 Identity = 28/30 (93.33%), Postives = 28/30 (93.33%), Query Frame = 0 Query: 1 SKLDPLPLDLHVLGLPPAFNLSHDQTLQFK 30 SKL LPLDLHVLGLPPAFNLSHDQTLQFK Sbjct: 22 SKLSVLPLDLHVLGLPPAFNLSHDQTLQFK 51
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: A0A6M5DAS2_9ENTR (Cell envelope biogenesis protein TolA n=1 Tax=Kosakonia sp. MUSA4 TaxID=2067958 RepID=A0A6M5DAS2_9ENTR) HSP 1 Score: 58.5 bits (140), Expect = 2.640e-10 Identity = 27/31 (87.10%), Postives = 28/31 (90.32%), Query Frame = 0 Query: 1 SKLDPLPLDLHVLGLPPAFNLSHDQTLQFKI 31 SKL LP DLHVLGLPPAFNLSHDQTLQFK+ Sbjct: 2 SKLSVLPSDLHVLGLPPAFNLSHDQTLQFKV 32
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: UPI001F3FD000 (hypothetical protein n=1 Tax=Halomonas titanicae TaxID=664683 RepID=UPI001F3FD000) HSP 1 Score: 59.7 bits (143), Expect = 2.990e-10 Identity = 30/40 (75.00%), Postives = 32/40 (80.00%), Query Frame = 0 Query: 17 PAFNLSHDQTLQFKII------PKAAKANQTWLKVQTNSF 50 PAFNLSHDQTLQFKI P+A KA+QTWLKVQTNSF Sbjct: 1 PAFNLSHDQTLQFKIYVILTCHPRATKADQTWLKVQTNSF 40
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Match: A0A077P9Y7_XENBV (Uncharacterized protein n=1 Tax=Xenorhabdus bovienii str. oregonense TaxID=1398202 RepID=A0A077P9Y7_XENBV) HSP 1 Score: 57.8 bits (138), Expect = 8.190e-10 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 0 Query: 1 SKLDPLPLDLHVLGLPPAFNLSHDQTLQFKI 31 ++ PLPLDLHVLGLPPAFNLSHDQTLQ K+ Sbjct: 24 ARFPPLPLDLHVLGLPPAFNLSHDQTLQLKV 54 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12627.2119.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12627.2119.1 ID=prot_L-elsbetiae_contig12627.2119.1|Name=mRNA_L-elsbetiae_contig12627.2119.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=64bpback to top |