prot_L-elsbetiae_contig116.1383.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig116.1383.1 vs. uniprot
Match: D8LDV3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDV3_ECTSI) HSP 1 Score: 73.6 bits (179), Expect = 1.050e-11 Identity = 49/104 (47.12%), Postives = 62/104 (59.62%), Query Frame = 0 Query: 106 MTRIEELARDVVLAVVPTKAVLLAPITELRGSGGSAGAVLAGRAEAAGARNVPPLLEILVNLSCADPHAVAAWLTS-GVSDWSPGSALAGLEAELNNRDEKVQI 208 MTR+EELAR +V V T LL PI + V AG +++ A + P+LE+LVNLSCADPHA+ WL S D SPG AL GL+ ELN+ EK + Sbjct: 1 MTRVEELARSLVPGAVSTGVALLMPILARKPHS----TVAAGPVDSSMASSAFPVLELLVNLSCADPHAIYNWLASCSPDDGSPGGALKGLKIELNSGVEKAVV 100 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig116.1383.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig116.1383.1 ID=prot_L-elsbetiae_contig116.1383.1|Name=mRNA_L-elsbetiae_contig116.1383.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=489bpback to top |