mRNA_L-elsbetiae_contig9733.18704.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: I2H7T7_TETBL (Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) TaxID=1071380 RepID=I2H7T7_TETBL) HSP 1 Score: 60.1 bits (144), Expect = 1.470e-7 Identity = 26/37 (70.27%), Postives = 30/37 (81.08%), Query Frame = 2 Query: 212 NCDPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 N D NP WCS+GVLYYQ+ QN DALDAYTRAI+L+ Sbjct: 442 NRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLN 478
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: A0A4P9Z1R2_9FUNG (Uncharacterized protein n=1 Tax=Syncephalis pseudoplumigaleata TaxID=1712513 RepID=A0A4P9Z1R2_9FUNG) HSP 1 Score: 58.5 bits (140), Expect = 4.560e-7 Identity = 24/32 (75.00%), Postives = 29/32 (90.62%), Query Frame = 2 Query: 227 NPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 NP WCS+GVLYYQ++Q RDALDAYTRAI+L+ Sbjct: 350 NPTYWCSIGVLYYQINQYRDALDAYTRAIRLN 381
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: A0A3M2SWT8_9EURO (Tetratricopeptide repeat protein n=1 Tax=Aspergillus sp. HF37 TaxID=1960876 RepID=A0A3M2SWT8_9EURO) HSP 1 Score: 58.5 bits (140), Expect = 4.800e-7 Identity = 24/35 (68.57%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 218 DPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 D NP WCS+GVLYYQ++Q RDALDAY+RAI+L+ Sbjct: 20 DGRNPTFWCSIGVLYYQINQYRDALDAYSRAIRLN 54
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: H0ETI7_GLAL7 (Putative General transcriptional corepressor ssn6 n=1 Tax=Glarea lozoyensis (strain ATCC 74030 / MF5533) TaxID=1104152 RepID=H0ETI7_GLAL7) HSP 1 Score: 58.5 bits (140), Expect = 4.940e-7 Identity = 24/35 (68.57%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 218 DPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 D NP WCS+GVLYYQ++Q RDALDAY+RAI+L+ Sbjct: 20 DGRNPTFWCSIGVLYYQINQYRDALDAYSRAIRLN 54
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: A0A4P9W4D1_9FUNG (Uncharacterized protein (Fragment) n=1 Tax=Blyttiomyces helicus TaxID=388810 RepID=A0A4P9W4D1_9FUNG) HSP 1 Score: 58.5 bits (140), Expect = 5.010e-7 Identity = 24/35 (68.57%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 218 DPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 D NP WCS+GVLYYQ++Q RDALDAY+RAI+L+ Sbjct: 3 DGRNPTFWCSIGVLYYQINQYRDALDAYSRAIRLN 37
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: A0A137PI57_CONC2 (TPR-like protein (Fragment) n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A137PI57_CONC2) HSP 1 Score: 58.2 bits (139), Expect = 6.180e-7 Identity = 24/35 (68.57%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 218 DPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 D NP WCS+GVLYYQ++Q RDALDAY+RAI+L+ Sbjct: 269 DGRNPTFWCSIGVLYYQINQFRDALDAYSRAIRLN 303
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: A0A060CBC2_9CYAN (CAZy families GT2|GT41 protein (Fragment) n=1 Tax=uncultured Cyanothece sp. TaxID=259951 RepID=A0A060CBC2_9CYAN) HSP 1 Score: 55.8 bits (133), Expect = 6.950e-7 Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 2 Query: 212 NCDPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 N D NP CS+GVLYYQ+ Q RDALDAYTRAI+L+ Sbjct: 99 NRDARNPTFXCSIGVLYYQISQYRDALDAYTRAIRLN 135
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: A0A4P6XMN8_9ASCO (Glucose repression mediator protein n=2 Tax=Metschnikowia TaxID=27320 RepID=A0A4P6XMN8_9ASCO) HSP 1 Score: 57.4 bits (137), Expect = 1.310e-6 Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 2 Query: 212 NCDPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 N D NP WC +GVLYYQ+ Q RDALDAYTRAI+L+ Sbjct: 371 NRDLRNPTFWCLIGVLYYQISQYRDALDAYTRAIRLN 407
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: A0A0J9XF12_GEOCN (Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XF12_GEOCN) HSP 1 Score: 56.6 bits (135), Expect = 2.120e-6 Identity = 22/34 (64.71%), Postives = 29/34 (85.29%), Query Frame = 2 Query: 218 DPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKL 319 D NP WCS+G+LY++++Q RDALDAYTRAI+L Sbjct: 321 DSQNPRFWCSIGILYFRINQYRDALDAYTRAIRL 354
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Match: UPI001B8772DB (uncharacterized protein n=1 Tax=Suillus bovinus TaxID=48563 RepID=UPI001B8772DB) HSP 1 Score: 55.5 bits (132), Expect = 2.420e-6 Identity = 22/35 (62.86%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 218 DPNNPNVWCSLGVLYYQLHQNRDALDAYTRAIKLD 322 D NP +WCS+GVLY+Q++Q RDALDAY+RAI ++ Sbjct: 16 DGRNPTLWCSIGVLYFQINQFRDALDAYSRAIHIN 50 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9733.18704.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 15
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig9733.18704.1 >prot_L-elsbetiae_contig9733.18704.1 ID=prot_L-elsbetiae_contig9733.18704.1|Name=mRNA_L-elsbetiae_contig9733.18704.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=117bp MLLYGRSADSVGVPPPSLFRSASAHVPVRVVPVSAATAIRTTRTSGVRWEback to top mRNA from alignment at L-elsbetiae_contig9733:1700..2374- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig9733.18704.1 ID=mRNA_L-elsbetiae_contig9733.18704.1|Name=mRNA_L-elsbetiae_contig9733.18704.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=675bp|location=Sequence derived from alignment at L-elsbetiae_contig9733:1700..2374- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig9733:1700..2374- >mRNA_L-elsbetiae_contig9733.18704.1 ID=mRNA_L-elsbetiae_contig9733.18704.1|Name=mRNA_L-elsbetiae_contig9733.18704.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=702bp|location=Sequence derived from alignment at L-elsbetiae_contig9733:1700..2374- (Laminarionema elsbetiae ELsaHSoW15)back to top |