mRNA_L-elsbetiae_contig9723.18694.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9723.18694.1 vs. uniprot
Match: A0A813I3N5_POLGL (Hypothetical protein (Fragment) n=1 Tax=Polarella glacialis TaxID=89957 RepID=A0A813I3N5_POLGL) HSP 1 Score: 50.1 bits (118), Expect = 1.280e-5 Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 1 Query: 31 AFLNEIGCTVVALAGCIPRGVLVFLPSYRILGEAVRVWRASGVS 162 AFL ++G T+V L GC+P GVL FLPSY + AV W+ S Sbjct: 379 AFLEDLGDTLVTLLGCMPGGVLCFLPSYAAIDAAVAAWKRQEAS 422
BLAST of mRNA_L-elsbetiae_contig9723.18694.1 vs. uniprot
Match: A0A813DPK9_POLGL (Hypothetical protein n=2 Tax=Polarella glacialis TaxID=89957 RepID=A0A813DPK9_POLGL) HSP 1 Score: 50.1 bits (118), Expect = 1.280e-5 Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 1 Query: 31 AFLNEIGCTVVALAGCIPRGVLVFLPSYRILGEAVRVWRASGVS 162 AFL ++G T+V L GC+P GVL FLPSY + AV W+ S Sbjct: 730 AFLEDLGDTLVTLLGCMPGGVLCFLPSYAAIDAAVAAWKRQEAS 773
BLAST of mRNA_L-elsbetiae_contig9723.18694.1 vs. uniprot
Match: A0A813DB55_POLGL (Hypothetical protein n=1 Tax=Polarella glacialis TaxID=89957 RepID=A0A813DB55_POLGL) HSP 1 Score: 50.1 bits (118), Expect = 1.280e-5 Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 1 Query: 31 AFLNEIGCTVVALAGCIPRGVLVFLPSYRILGEAVRVWRASGVS 162 AFL ++G T+V L GC+P GVL FLPSY + AV W+ S Sbjct: 1043 AFLEDLGDTLVTLLGCMPGGVLCFLPSYAAIDAAVAAWKRQEAS 1086
BLAST of mRNA_L-elsbetiae_contig9723.18694.1 vs. uniprot
Match: A0A4S4M7J8_9AGAM (ATP-dependent DNA helicase CHL1 n=1 Tax=Bondarzewia mesenterica TaxID=1095465 RepID=A0A4S4M7J8_9AGAM) HSP 1 Score: 48.9 bits (115), Expect = 3.260e-5 Identity = 19/48 (39.58%), Postives = 34/48 (70.83%), Query Frame = 1 Query: 16 NMRDDAFLNEIGCTVVALAGCIPRGVLVFLPSYRILGEAVRVWRASGV 159 N+ + + + E+G ++ LA +P G++VFLPSYR+L +A+ VW+ G+ Sbjct: 542 NLSNQSLIIELGQLLLNLARLVPGGMVVFLPSYRVLNQALSVWKEGGL 589
BLAST of mRNA_L-elsbetiae_contig9723.18694.1 vs. uniprot
Match: A0A1Y2G4S4_9BASI (ATP-dependent DNA helicase CHL1 n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2G4S4_9BASI) HSP 1 Score: 47.8 bits (112), Expect = 8.400e-5 Identity = 18/46 (39.13%), Postives = 32/46 (69.57%), Query Frame = 1 Query: 22 RDDAFLNEIGCTVVALAGCIPRGVLVFLPSYRILGEAVRVWRASGV 159 +D+ L+E+G ++V +A +P+G++VF+PSY L + W ASG+ Sbjct: 674 KDEKLLDELGQSIVNIAQVVPKGIVVFVPSYDFLNQVQARWEASGM 719
BLAST of mRNA_L-elsbetiae_contig9723.18694.1 vs. uniprot
Match: A0A316UHP8_9BASI (ATP-dependent DNA helicase CHL1 n=1 Tax=Pseudomicrostroma glucosiphilum TaxID=1684307 RepID=A0A316UHP8_9BASI) HSP 1 Score: 47.8 bits (112), Expect = 8.400e-5 Identity = 20/44 (45.45%), Postives = 29/44 (65.91%), Query Frame = 1 Query: 25 DDAFLNEIGCTVVALAGCIPRGVLVFLPSYRILGEAVRVWRASG 156 D A L+++G + A IP GV+VFLPSY++L E V W+ +G Sbjct: 698 DTALLDDLGNAIANFAALIPHGVVVFLPSYKLLDELVARWKETG 741 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9723.18694.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig9723.18694.1 >prot_L-elsbetiae_contig9723.18694.1 ID=prot_L-elsbetiae_contig9723.18694.1|Name=mRNA_L-elsbetiae_contig9723.18694.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=49bp MRDDAFLNEIGCTVVALAGCIPRGVLVFLPSYRILGEAVRVWRASGVS*back to top mRNA from alignment at L-elsbetiae_contig9723:148..312+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig9723.18694.1 ID=mRNA_L-elsbetiae_contig9723.18694.1|Name=mRNA_L-elsbetiae_contig9723.18694.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=165bp|location=Sequence derived from alignment at L-elsbetiae_contig9723:148..312+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig9723:148..312+ >mRNA_L-elsbetiae_contig9723.18694.1 ID=mRNA_L-elsbetiae_contig9723.18694.1|Name=mRNA_L-elsbetiae_contig9723.18694.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=294bp|location=Sequence derived from alignment at L-elsbetiae_contig9723:148..312+ (Laminarionema elsbetiae ELsaHSoW15)back to top |